Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate 5207560 Shew_0094 ABC transporter-related protein (RefSeq)
Query= uniprot:A8LLL2 (373 letters) >FitnessBrowser__PV4:5207560 Length = 369 Score = 147 bits (372), Expect = 3e-40 Identities = 102/268 (38%), Positives = 147/268 (54%), Gaps = 17/268 (6%) Query: 29 GELIVFVGPSGCGKSTLLRMIAGLEKITGGTLEIDGTVVND------VPPAQRGIAMVFQ 82 GE++ VGPSG GKSTL+RMIAGL K G + +V + P QR + V Q Sbjct: 29 GEVLAVVGPSGGGKSTLMRMIAGLTKPESGEIRYGDSVWFSSESGRYLTPQQRHLGYVPQ 88 Query: 83 SYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEKLQLGQYLDRLPKALSGGQRQRV 142 + L+P+MT N+ AL K AE A + E++ L DRLP LSGGQRQRV Sbjct: 89 HFGLFPNMTALANVVAALDHIPK--AERVARAKDWLERVNLHGLPDRLPANLSGGQRQRV 146 Query: 143 AIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLKEAMPESTMVYVTHDQVEAMTLA 202 A+ R++ R+P+V L DEP S +D R LE+A+LKE + ++ VTHD EA+ LA Sbjct: 147 ALARALAREPRVLLLDEPFSAVDRETRERLYLELARLKEQL-AIPVIMVTHDLNEALLLA 205 Query: 203 TRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKMNLLPGKIIGTGAQTTVE-MTDG 261 R+++++ G + Q GSP E+ +P NE VA+ +G NL ++ A+ + + G Sbjct: 206 DRMILISQGTLLQQGSPREVLSRPRNEAVAKQMG--LRNLFDAHVVAQEAERQITWLRFG 263 Query: 262 GRAVSDYPSDDSLMGAAV-----NVGVR 284 ++ + +GA V N GVR Sbjct: 264 EHLIAGNYCEQLAIGAKVRWVIPNQGVR 291 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 369 Length adjustment: 30 Effective length of query: 343 Effective length of database: 339 Effective search space: 116277 Effective search space used: 116277 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory