Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate 5210976 Shew_3402 ABC transporter-related protein (RefSeq)
Query= SwissProt::Q9F9B0 (260 letters) >FitnessBrowser__PV4:5210976 Length = 322 Score = 104 bits (259), Expect = 3e-27 Identities = 70/226 (30%), Positives = 126/226 (55%), Gaps = 17/226 (7%) Query: 5 PILTARGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGEIR 64 PI++ G+ KRY +V+AL+R DF+L+PGE++ + G NGAGK++++K I G + +G+++ Sbjct: 9 PIVSLSGVAKRYAKVSALERIDFELFPGEVMGLFGHNGAGKTTIMKLILGIIPASDGQVK 68 Query: 65 LEGKPIQFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSLDRA 124 + G+ + EAR+ + + +N++ L+ GRE+ ++F L Sbjct: 69 VFGQDPLSKQAFEARKQ-VGYLPENVSFYDQLT-------GREVL------RYFARL--K 112 Query: 125 AMEKQARAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGV 184 ++ KQA +L E +T +++ V+T S G RQ + +A+A K++++DEPT L Sbjct: 113 SVPKQAIEQLLEQVGLT-HAMDRQVKTYSKGMRQRLGLAQAFLGSPKLLLLDEPTVGLDP 171 Query: 185 KESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLGRRL 230 ++ + ++ G I+L SH +P V + DR I GR L Sbjct: 172 IATQEFYASVDKLKSEGASIILCSHVLPGVEQHIDRALIISGGRLL 217 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 322 Length adjustment: 26 Effective length of query: 234 Effective length of database: 296 Effective search space: 69264 Effective search space used: 69264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory