Align UTP--glucose-1-phosphate uridylyltransferase; EC 2.7.7.9 (characterized)
to candidate 5208917 Shew_1418 UTP-glucose-1-phosphate uridylyltransferase GalU (RefSeq)
Query= CharProtDB::CH_021667 (302 letters) >FitnessBrowser__PV4:5208917 Length = 306 Score = 422 bits (1084), Expect = e-123 Identities = 211/288 (73%), Positives = 240/288 (83%), Gaps = 2/288 (0%) Query: 10 KAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIE 69 K VIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQY+VNEC++AG+ EIVLVTH+SKN+IE Sbjct: 14 KVVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYIVNECVSAGVKEIVLVTHASKNAIE 73 Query: 70 NHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDE 129 NHFDTS+ELE+ LEKRVKRQLLDEVQSICP VTIM VRQG AKGLGHAVLCA P +G+ Sbjct: 74 NHFDTSYELESTLEKRVKRQLLDEVQSICPKDVTIMHVRQGEAKGLGHAVLCAKPCIGNN 133 Query: 130 PVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVA--DVTAYGVVDCKGVE 187 P AV+LPDVILDEY +D S +NLA MI+ + T SQIMV PVA +V YG+ DC GV Sbjct: 134 PFAVVLPDVILDEYSADQSSENLAAMIKHYKATQASQIMVAPVALDEVNKYGIADCGGVN 193 Query: 188 LAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQLTDAIDM 247 + PGES + +VEKP D APSNLA+VGRYVLS IW LLAKTP GAGDEIQLTDAIDM Sbjct: 194 IEPGESSVIKAMVEKPAIDEAPSNLAVVGRYVLSEKIWDLLAKTPAGAGDEIQLTDAIDM 253 Query: 248 LIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLE 295 LIE +TVEA++M GKSHDCG+KLGYM AFVEYG+R+ LG EF+ L+ Sbjct: 254 LIESDTVEAFNMTGKSHDCGDKLGYMAAFVEYGLRNEKLGKEFRQQLD 301 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 306 Length adjustment: 27 Effective length of query: 275 Effective length of database: 279 Effective search space: 76725 Effective search space used: 76725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate 5208917 Shew_1418 (UTP-glucose-1-phosphate uridylyltransferase GalU (RefSeq))
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.25071.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-119 382.1 0.4 8.2e-119 381.9 0.4 1.0 1 lcl|FitnessBrowser__PV4:5208917 Shew_1418 UTP-glucose-1-phosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5208917 Shew_1418 UTP-glucose-1-phosphate uridylyltransferase GalU (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 381.9 0.4 8.2e-119 8.2e-119 2 261 .] 13 281 .. 12 281 .. 0.97 Alignments for each domain: == domain 1 score: 381.9 bits; conditional E-value: 8.2e-119 TIGR01099 2 rkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDtsyeleaklekkn 79 +k+viP+aGlGtr+LPatkaiPkemlp+vdkPliqy+v+e+v aG++eivlvt+ sk+aie+hfDtsyele++lek+ lcl|FitnessBrowser__PV4:5208917 13 MKVVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYIVNECVSAGVKEIVLVTHASKNAIENHFDTSYELESTLEKRV 90 79**************************************************************************** PP TIGR01099 80 keellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepfavllgDdlvseeee.....alkqlielyektga 151 k++ll+ev++i+++ +ti++vrq eakGLGhavl+a++++g++pfav+l+D++++e ++ +l+ +i+ y+ t+a lcl|FitnessBrowser__PV4:5208917 91 KRQLLDEVQSICPKdVTIMHVRQGEAKGLGHAVLCAKPCIGNNPFAVVLPDVILDEYSAdqsseNLAAMIKHYKATQA 168 *************99***************************************9887667788************** PP TIGR01099 152 siiaveevpkeevskYGvidgeeveeelye...vkdlvekPkpeeapsnlaivGrYvltpeifelleetkaGkggeiq 226 s+i+v v+ +ev+kYG++d+ +v+ e e +k++vekP +eapsnla+vGrYvl+ +i++ll++t+aG+g+eiq lcl|FitnessBrowser__PV4:5208917 169 SQIMVAPVALDEVNKYGIADCGGVNIEPGEssvIKAMVEKPAIDEAPSNLAVVGRYVLSEKIWDLLAKTPAGAGDEIQ 246 **********************99877666667********************************************* PP TIGR01099 227 ltDalrlllekeevlavklkgkryDvGdklgylka 261 ltDa+++l+e+++v+a++++gk++D+Gdklgy+ a lcl|FitnessBrowser__PV4:5208917 247 LTDAIDMLIESDTVEAFNMTGKSHDCGDKLGYMAA 281 ********************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (306 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.56 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory