Align ABC transporter (characterized, see rationale)
to candidate 5208351 Shew_0863 ABC transporter-related protein (RefSeq)
Query= uniprot:A0A166QFW2 (381 letters) >FitnessBrowser__PV4:5208351 Length = 342 Score = 202 bits (513), Expect = 1e-56 Identities = 125/325 (38%), Positives = 194/325 (59%), Gaps = 18/325 (5%) Query: 1 MIKLKLDNVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDL 60 M L ++ V+ G ILR + L + GE +GPSGCGK+TLL+ IAGL I G + Sbjct: 1 MSTLTIEQVHSDYQGQTILRGLDLVLHQGEIAALLGPSGCGKTTLLKAIAGLQPISQGRI 60 Query: 61 LIDGRRVNDLE---PRERG-VGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLK 116 I+GR ++ E P ER VGM+FQ YAL+PH++V +NI FG+K DK + + R+ + Sbjct: 61 SINGRLLSGPETFVPSERREVGMIFQDYALFPHLTVAENILFGVK--GLDKAARQARLGE 118 Query: 117 TAQILQLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEI 176 +++L+ L R P ELSGGQ+QRV++ RA+A EP++LL DEP SN+DA +R +M EI Sbjct: 119 MLALVKLEGLGGRYPHELSGGQQQRVSIARALAYEPELLLLDEPFSNIDAKVRGEMMVEI 178 Query: 177 ARLHDRLGSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGS 236 + + G + ++VTH + EA ADK+ + G + Q GS LY P ++VA FLG Sbjct: 179 REILKQRGVSAVFVTHSKDEAFVFADKLALFKDGGIAQYGSAESLYAEPTDKYVAEFLG- 237 Query: 237 PRMNFLSARLQTPGETSLVDTLVWGITSLPFDSSNL--AAGTPLSLGIRPEHVSLKAADG 294 ++N+LS ++ + + + TL+ + S SS+L AAG L +RPE + + + Sbjct: 238 -QVNYLSCEVK---DRARLQTLLGEVQS----SSDLPKAAGYRGELLLRPEQLQMAGDEQ 289 Query: 295 TAGVVVTAVEYLGSETYVHLETGQD 319 G ++ A +LG+ + + G++ Sbjct: 290 GEGTII-ARRFLGNLCHYSILIGEE 313 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 342 Length adjustment: 29 Effective length of query: 352 Effective length of database: 313 Effective search space: 110176 Effective search space used: 110176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory