Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate 5208375 Shew_0887 D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding (RefSeq)
Query= BRENDA::F8A9V0 (325 letters) >FitnessBrowser__PV4:5208375 Length = 317 Score = 144 bits (364), Expect = 2e-39 Identities = 102/283 (36%), Positives = 146/283 (51%), Gaps = 27/283 (9%) Query: 38 VEKAKGAQVVSLFVSDKADGPVLEALHSYG-VGLLALRSAGYDHIDIETAKRLGIKVVNV 96 +++A+GAQV+ L D L AL +G+LA G + +D+ A+ LGIKV NV Sbjct: 39 LDRAQGAQVL-LTNKTVLDADALRALPDLEYIGVLA---TGTNVVDLNAARELGIKVTNV 94 Query: 97 PAYSPHAIADHTLAIMLALIRRLHRAHDKVRLG------DFDLDGLMGFDLNGKVAGVIG 150 P Y P A+A A +L +RL H+ V G DF L GK G++G Sbjct: 95 PGYGPDAVAQMVFAHILHHTQRLSDHHNAVVAGAWSQAPDFCFTLAPLQSLKGKTLGLVG 154 Query: 151 LGKIGRLVATRLKAFGCKVLGYDPYIQPEIVENV---DLDTLITQADIISIHCPLTRENF 207 G IGR VA KAF +VL P I+ ++ E V + + L ADIIS+HCPLT + Sbjct: 155 FGDIGRQVANIAKAFQMRVLVNTPSIKHDLPEGVSWCEREALFASADIISLHCPLTPDTE 214 Query: 208 HMFNEETFKRMKPGAILVNTARGGLIDTKALLEALKSGKLGGAALDVYEYERGLFFKNHQ 267 + N E MKP AIL+NTARGGL+D +AL AL G++ A +DV E Sbjct: 215 KLINRERLSAMKPNAILINTARGGLVDEQALANALAQGEIAAAGVDVLSSE--------- 265 Query: 268 KEGIKDPYLAQLLGLANVVLTGHQAFLTREAVKNIEETTVENI 310 +P LL ++ ++ H ++ T+EA + + V+N+ Sbjct: 266 PPQADNP----LLSAPHISISPHNSWATKEARQQLLTIAVDNL 304 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 317 Length adjustment: 28 Effective length of query: 297 Effective length of database: 289 Effective search space: 85833 Effective search space used: 85833 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory