Align Aminomethyltransferase (EC 2.1.2.10) (characterized)
to candidate 5210636 Shew_3064 glycine cleavage system aminomethyltransferase T (RefSeq)
Query= reanno::Koxy:BWI76_RS23880 (364 letters) >FitnessBrowser__PV4:5210636 Length = 364 Score = 514 bits (1323), Expect = e-150 Identities = 251/361 (69%), Positives = 294/361 (81%) Query: 1 MAQQTPLFEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRGDAGMFDVSHMTIVDFHGS 60 MA +T LF +H A+MVDFHGW MPL+YGSQI+EHH VR DAGMFDVSHMT+VD G+ Sbjct: 1 MANKTVLFNKHLEANAKMVDFHGWDMPLNYGSQIEEHHVVRQDAGMFDVSHMTVVDVTGA 60 Query: 61 RIREFLRYLLANDVAKLTVPGKALYSGMLTASGGVIDDLIVYFLSEDYFRLVVNSATREK 120 +FLR LLANDVAKL VPGKALY GML + GVIDDLI Y+LS+ ++R+VVNSATREK Sbjct: 61 EACDFLRKLLANDVAKLKVPGKALYGGMLDHNAGVIDDLITYYLSDTHYRIVVNSATREK 120 Query: 121 DLAWIAQQSESYGLEITVRDDLSLIAVQGPRAKEKAATLFTDAQRQAVEGMKPFFGVQAG 180 DLAWI +Q + Y + +T R +L++IAVQGP AK KAA +FTD Q AVEGMKPFFGVQ+G Sbjct: 121 DLAWITEQVKGYDVTVTERPELAMIAVQGPNAKAKAAAVFTDEQNAAVEGMKPFFGVQSG 180 Query: 181 DLFIATTGYTGEAGYEIALPNEQAVDFWRGLLDAGVKPCGLGARDTLRLEAGMNLYGQEM 240 LFIATTGYTGEAGYEI +P +A W+ LLD GVKPCGLGARDTLRLEAGMNLYGQ+M Sbjct: 181 SLFIATTGYTGEAGYEIIVPEAEAEALWQALLDNGVKPCGLGARDTLRLEAGMNLYGQDM 240 Query: 241 DEGVSPLAANMGWTIAWEPTDRDFIGREALEMQREKGTEQLVGLVMTEKGVLRGGLPVRF 300 DE V+PLAANMGWTIAWEP DRDFIGREAL + GT++LVGLVM KGVLR G+PV F Sbjct: 241 DESVNPLAANMGWTIAWEPEDRDFIGREALAAIKAAGTDKLVGLVMEAKGVLRTGMPVFF 300 Query: 301 SDADGNQKEGIITSGTFSPTLGYSIALARVPEGIGETAVVQIRNREMPVKVTKPVFVRNG 360 +DADG +++G ITSGTFSPTLGYSIA+ARVP +G+ A V++R + +PVKV P FVRNG Sbjct: 301 TDADGVEQQGAITSGTFSPTLGYSIAMARVPNSVGDVAEVEMRKKRVPVKVIAPSFVRNG 360 Query: 361 K 361 K Sbjct: 361 K 361 Lambda K H 0.320 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 364 Length adjustment: 29 Effective length of query: 335 Effective length of database: 335 Effective search space: 112225 Effective search space used: 112225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 5210636 Shew_3064 (glycine cleavage system aminomethyltransferase T (RefSeq))
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.1996787.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-142 459.7 0.1 3.6e-142 459.5 0.1 1.0 1 lcl|FitnessBrowser__PV4:5210636 Shew_3064 glycine cleavage syste Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5210636 Shew_3064 glycine cleavage system aminomethyltransferase T (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 459.5 0.1 3.6e-142 3.6e-142 2 362 .] 3 359 .. 2 359 .. 0.98 Alignments for each domain: == domain 1 score: 459.5 bits; conditional E-value: 3.6e-142 TIGR00528 2 krtpLydlhtelggklvdfaGwelPvqykslieeheavrtkaGlfDvshmgkvelsGskslkfLqrllanDvdaLtk. 78 ++t L++ h e +k+vdf+Gw +P++y+s+ieeh+ vr++aG+fDvshm+ v+++G ++ +fL++llanDv++L + lcl|FitnessBrowser__PV4:5210636 3 NKTVLFNKHLEANAKMVDFHGWDMPLNYGSQIEEHHVVRQDAGMFDVSHMTVVDVTGAEACDFLRKLLANDVAKLKVp 80 79*************************************************************************988 PP TIGR00528 79 GkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtlskeisllalqGP....kak 152 Gka+y ++l + Gv+DDli y+ ++ ++++vvn+at+ekDl+w++e++++ t + e++++a+qGP ka+ lcl|FitnessBrowser__PV4:5210636 81 GKALYGGMLDHNAGVIDDLITYYLSDT-HYRIVVNSATREKDLAWITEQVKGYDVTVTERPELAMIAVQGPnakaKAA 157 ************************999.*******************************************9999999 PP TIGR00528 153 tiledlldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekavelwkklveaygvkPiGLgarDtLrl 230 +++ d +++aveg+k+ff+vq + l +ia+tGytGe+G+ei+v++ +a lw++l+++ gvkP+GLgarDtLrl lcl|FitnessBrowser__PV4:5210636 158 AVFTDEQNAAVEGMKPFFGVQSGSL-----FIATTGYTGEAGYEIIVPEAEAEALWQALLDN-GVKPCGLGARDTLRL 229 *************************.....********************************.*************** PP TIGR00528 231 eagmaLyGqeldeeitPleaglgwvvkkerkksdfiGravleeqkengtekklvGlemlekgiarnelkvllt..nge 306 eagm+LyGq++de++ Pl+a++gw++++e++++dfiGr++l k+ gt+k lvGl+m +kg++r +++v++t +g lcl|FitnessBrowser__PV4:5210636 230 EAGMNLYGQDMDESVNPLAANMGWTIAWEPEDRDFIGREALAAIKAAGTDK-LVGLVMEAKGVLRTGMPVFFTdaDGV 306 *************************************************99.********************966677 PP TIGR00528 307 kevGivtsGtlsPtLgknialayvdkelekiGtklevevrnklvkikvvkklfvrs 362 ++ G +tsGt+sPtLg++ia+a+v+ + +G+++eve+r+k v++kv+ + fvr+ lcl|FitnessBrowser__PV4:5210636 307 EQQGAITSGTFSPTLGYSIAMARVP---NSVGDVAEVEMRKKRVPVKVIAPSFVRN 359 99***********************...99***********************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 23.59 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory