Align hydroxyacylglutathione hydrolase (EC 3.1.2.6) (characterized)
to candidate 5209661 Shew_2114 hydroxyacylglutathione hydrolase (RefSeq)
Query= BRENDA::Q8ZRM2 (251 letters) >FitnessBrowser__PV4:5209661 Length = 260 Score = 195 bits (495), Expect = 9e-55 Identities = 109/254 (42%), Positives = 147/254 (57%), Gaps = 9/254 (3%) Query: 6 IPAFQDNYIWVL-TNDEGRCVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVKE 64 IPAF DNYIW++ D G +VDPG+A VL + +H+ + + I +THHH DH GG+ E Sbjct: 7 IPAFNDNYIWLIHAKDSGGHYVVDPGDAKAVLDYLEQHQIVLDGILITHHHSDHTGGIAE 66 Query: 65 L-LQHFPQMTVYGPAETQDKGATHLVGDGDTIRVLGEKF----TLFATPGHTLGHVCYFS 119 L H ++TVYGP KG H + G T V EK +F PGHTLGH+ Y Sbjct: 67 LQASHDHKLTVYGPDNENIKGINHPIS-GQTESVKPEKLDSDAAVFHLPGHTLGHIAYLI 125 Query: 120 RPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSIL 179 +LFCGDTLFS GCGRLFEGTP+QM+ SL + L + TL+ AHEYT AN+ FAL++ Sbjct: 126 DDHLFCGDTLFSAGCGRLFEGTPAQMHHSLQTLAQLDETTLVYPAHEYTQANLAFALTVE 185 Query: 180 PHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETI--LQQP 237 + + + KVK+LR + +LP + E++IN FLR E + ++ + Sbjct: 186 NDNEALIAHAAKVKQLRDQNLPSLPSSIGLEKQINPFLRPEQASIKQNLSCHFAQDVTDD 245 Query: 238 EARFAWLRSKKDTF 251 F LR KD F Sbjct: 246 GTSFTLLRQWKDNF 259 Lambda K H 0.323 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 260 Length adjustment: 24 Effective length of query: 227 Effective length of database: 236 Effective search space: 53572 Effective search space used: 53572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate 5209661 Shew_2114 (hydroxyacylglutathione hydrolase (RefSeq))
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.1823211.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-99 315.9 0.4 1e-98 315.7 0.4 1.0 1 lcl|FitnessBrowser__PV4:5209661 Shew_2114 hydroxyacylglutathione Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209661 Shew_2114 hydroxyacylglutathione hydrolase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 315.7 0.4 1e-98 1e-98 1 248 [] 4 259 .. 4 259 .. 0.95 Alignments for each domain: == domain 1 score: 315.7 bits; conditional E-value: 1e-98 TIGR03413 1 iiaipalsdNyiwllkdeks.eavvvDpgeaepvlealeekglkleaillTHhHaDHvggvaellekfp..vkvvgpa 75 +++ipa++dNyiwl++ ++s +vvDpg+a+ vl++le++++ l+ il+THhH+DH+gg+ael+++++ ++v+gp+ lcl|FitnessBrowser__PV4:5209661 4 VTPIPAFNDNYIWLIHAKDSgGHYVVDPGDAKAVLDYLEQHQIVLDGILITHHHSDHTGGIAELQASHDhkLTVYGPD 81 579*****************9********************************************998878******* PP TIGR03413 76 eeripgltkevkeg.devel..lelevevlevpGHtlgHiayyleeekvlFcgDtLfsaGCGrlfegtaeqmleslqk 150 +e+i+g++++++ + ++v+ l++++ v++ pGHtlgHiay+++ ++lFcgDtLfsaGCGrlfegt++qm++slq lcl|FitnessBrowser__PV4:5209661 82 NENIKGINHPISGQtESVKPekLDSDAAVFHLPGHTLGHIAYLID--DHLFCGDTLFSAGCGRLFEGTPAQMHHSLQT 157 ***********865156665668999*******************..9****************************** PP TIGR03413 151 laaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealrakgkptlPstlaeekatNpFLraeeaevkaale 228 la+L+e+t+vy+aHEYt++Nl+Fal+ve +neal +++++v++lr+++ p+lPs+++ ek++NpFLr e+a++k++l+ lcl|FitnessBrowser__PV4:5209661 158 LAQLDETTLVYPAHEYTQANLAFALTVENDNEALIAHAAKVKQLRDQNLPSLPSSIGLEKQINPFLRPEQASIKQNLS 235 ***************************************************************************999 PP TIGR03413 229 e....ekaeevevfaelRekkdkf 248 + +++ + f+ lR++kd+f lcl|FitnessBrowser__PV4:5209661 236 ChfaqDVTDDGTSFTLLRQWKDNF 259 8777677888999*********98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (260 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 22.63 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory