Align Lactate utilization protein B (characterized)
to candidate 5210577 Shew_3005 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)
Query= SwissProt::O07021 (479 letters) >FitnessBrowser__PV4:5210577 Length = 462 Score = 293 bits (751), Expect = 6e-84 Identities = 170/440 (38%), Positives = 246/440 (55%), Gaps = 27/440 (6%) Query: 34 LRTRRLEAAEELGNWEEWRSLSEEIRQHVLENLDFYLGQLAENVAKRGGHVYFAKTAEEA 93 LR +R AA L WE+ R L E++ H L +L YL +N G V++AK E Sbjct: 37 LREKRDRAAASLPEWEQLRQLGSEMKLHTLTHLGEYLETFEKNCQANGIVVHWAKDGAEH 96 Query: 94 SSYIRDVIQKKNGKKIVKSKSMVTEEINLNEVLEKEGCEVVETDLGEYILQIDDHDPPSH 153 + + +++ K KK+VKSKSM+TEE +LN LE +G EV++TDLGE I+Q+ PPSH Sbjct: 97 NQIVHNILAKHQVKKLVKSKSMLTEECHLNPYLESKGIEVIDTDLGERIIQL-AKQPPSH 155 Query: 154 IVAPALHKNKEQIRDVFKERLDYQ-HTEKPEELVMHARAILRKKFLEADIGITGCNFAIA 212 IV PA+H KE++ D+F ++L + P L ARA LR++FL AD +TG N AIA Sbjct: 156 IVVPAIHLKKEEVGDLFHDKLGTEAGASDPLYLTRAARAHLREQFLSADAAMTGVNMAIA 215 Query: 213 DTGSVSLVTNEGNGRLVSTLPKTQITVMGMERIVPSFSEFEVLVSMLTRSAVGQRLTSYI 272 D G+V + TNEGN + + LPK Q+ MG+++IVP +L+ L R+A GQ +T+Y Sbjct: 216 DKGAVVVCTNEGNADMGANLPKLQLHSMGIDKIVPDLDSAAILLRTLARNATGQPITTYS 275 Query: 273 TALTGPKLEGEVDGPEEFHLVIVDNGRSNILGTE-FQSVLQCIRCAACINVCPVYRHVGG 331 + GP+ GE+ H++IVDNGR+++L + L+CIRC C+N CPVYR GG Sbjct: 276 SFYRGPQDGGEM------HVIIVDNGRTDMLQDKILAESLKCIRCGGCLNTCPVYRRSGG 329 Query: 332 HSYGSIYSGPIGAVLSPLLGGYDDYKELPYASSLCAACSEACPVKIPLHELLLKHRQNIV 391 +SY GPIG + DD +P+A +LC +CS CP K+PL +++ HR+ + Sbjct: 330 YSYNYTIPGPIGIAVG---AQADDTHSIPWACTLCGSCSYVCPTKVPLDKIIHHHRR-LK 385 Query: 392 EKEGRAPISEKLAMKAFGLGASSLSLYKMGSKWAPAAMTPFTEDEKISKGPGPLKN---- 447 K G+ P ++ M G +S ++ A A+ PG L Sbjct: 386 AKAGKLPYGKRNYMPLVGNFMASETMLNCSMSVARTALRIL---------PGSLLKPFSG 436 Query: 448 -WTQIRDFPAPHKSRFRDWF 466 W + R+ P KS F WF Sbjct: 437 AWGKYRELPVAPKSSFEAWF 456 Lambda K H 0.316 0.134 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 14 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 462 Length adjustment: 33 Effective length of query: 446 Effective length of database: 429 Effective search space: 191334 Effective search space used: 191334 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory