Align Tryptophan-specific transport protein; Tryptophan permease (characterized)
to candidate 5211115 Shew_3531 aromatic amino acid transporter (RefSeq)
Query= SwissProt::Q02DS7 (417 letters) >FitnessBrowser__PV4:5211115 Length = 418 Score = 479 bits (1233), Expect = e-140 Identities = 248/404 (61%), Positives = 305/404 (75%), Gaps = 3/404 (0%) Query: 14 SLLGGSMIIAGTAVGAGMFSLPIAMSGIWFGWSVAVFLLTWFCMLLSGMMILEANLNYPV 73 SLLGG+MIIAGTAVGAGMFSLP+ +G+WF +SV + L WFCML+SG+++LE NL+Y Sbjct: 16 SLLGGAMIIAGTAVGAGMFSLPVVGAGMWFSYSVLMMLGVWFCMLVSGLLLLETNLHYEP 75 Query: 74 GSSFSTITRDLLGQGWNVVNGLSIAFVLYILTYAYISGGGSIIGYTLSSGLGVTLPEKLA 133 G+SF T+TRD LG W +VNGLSIAFVLYIL YAYISGGGSI+ ++LSS LGV LP+ A Sbjct: 76 GASFDTLTRDTLGNFWRIVNGLSIAFVLYILAYAYISGGGSIVNHSLSS-LGVELPQSFA 134 Query: 134 GLLFALAVALVVWWSTRAVDRITTLMLGGMIITFGLSISGLLGRIQPAILFNSGEPDAVY 193 GL+FA+ +A++V+ ST+AVDRITT+MLGGMIITF L+I LL ++PA LF + +A Y Sbjct: 135 GLVFAVGLAIIVFISTKAVDRITTIMLGGMIITFFLAIGNLLIEVEPAKLFVP-DGEANY 193 Query: 194 WPYLLATLPFCLTSFGYHGNVPSLMKYYGKDPQRISRSLWIGTLIALAIYLLWQASTLGT 253 PY+LA +PF L SFGYHGNVPSL+KYYGKDP I +++ +GTLIA IYL W +T+G Sbjct: 194 LPYMLAAIPFGLVSFGYHGNVPSLVKYYGKDPGTIVKAITLGTLIAFVIYLCWLVATMGN 253 Query: 254 IPREQFKGIIAGGSNVGTLVEYLHRITASDSLNALLTTFSNLAVASSFLGVTLGLFDYLA 313 I R F +IA G N+G LV L + ASD L +LT F+NLAVASSFLGVTLGLFDYLA Sbjct: 254 ITRSGFVEVIAQGGNMGVLVAALSDVMASDWLTTMLTLFANLAVASSFLGVTLGLFDYLA 313 Query: 314 DLCRFDDSHFGRFKTALLTFVPPTIGGLLFPNGFIYAIGFAGLAAAFWAVIVPALMARAS 373 DL FD+S GR KTA +TF+PPT+ GLLFPNGF+ AIGFA LAA WA IVPALMA + Sbjct: 314 DLFGFDESRTGRLKTAAVTFLPPTVLGLLFPNGFLIAIGFAALAATVWAAIVPALMAYRA 373 Query: 374 RKRF-GSPLFRAWGGTPAIVLVLLFGVANAVAHILASLHWLPEY 416 R+ F S FR GGT I +V+ +G+ A H+LA LP Y Sbjct: 374 RQMFPDSQSFRVPGGTVVIAIVIFYGLLTAACHLLAMADLLPMY 417 Lambda K H 0.326 0.141 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 598 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 418 Length adjustment: 32 Effective length of query: 385 Effective length of database: 386 Effective search space: 148610 Effective search space used: 148610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory