GapMind for catabolism of small carbon sources

 

Aligments for a candidate for brnQ in Shewanella loihica PV-4

Align Branched chain amino acid: Na+ symporter (characterized)
to candidate 5208257 Shew_0769 branched-chain amino acid transport system II carrier protein (RefSeq)

Query= TCDB::P19072
         (437 letters)



>lcl|FitnessBrowser__PV4:5208257 Shew_0769 branched-chain amino acid
           transport system II carrier protein (RefSeq)
          Length = 443

 Score =  372 bits (954), Expect = e-107
 Identities = 197/436 (45%), Positives = 283/436 (64%), Gaps = 18/436 (4%)

Query: 8   DLLALGFMTFALFLGAGNIIFPPSAGMAAGEHVWSAAFGFLLTGVGLPLLTVVALARVGG 67
           D L LGFMTFA FLGAGN+IFPP AG  AGE++  A  GFLLT V LPL+T++A+A+  G
Sbjct: 10  DTLGLGFMTFAFFLGAGNLIFPPLAGFLAGENMSWAMIGFLLTAVTLPLVTLIAVAKANG 69

Query: 68  GIGRLTQPIGRRAGVAFAIAVYLAIGPLFATPRTAVVSFEMGVAPFTGDGGVPL------ 121
            +  L  P+   A    AIA+Y+ IGP FA PR  +V++EMG  PF  D           
Sbjct: 70  KVMGLLPPL---AATMLAIAIYIIIGPAFAAPRAGLVAYEMGYKPFIQDAQASFEVAGVV 126

Query: 122 -----LIYTVAYFSVVLFLVLNPGRLVDRVGKVITPVLLSALLVLGGAAIFAPAGEIGSS 176
                L+YT  +F + + L L PG+L+D VGKV+TP+++  L+ L  + +  P  ++ ++
Sbjct: 127 FTSSQLLYTSIFFGIAMLLSLFPGKLLDSVGKVLTPIMIILLVGLAISVVVLPGSDVAAA 186

Query: 177 SGEYQSAPLVQGFLQGYLTMDTLGALVFGIVIATAIRDRGISDSRLVTRYSMIAGVIAAT 236
            G+YQ+ PL +G ++GY TMDTL +L+FG++I   +R +G+   R  T+Y + A  IAA 
Sbjct: 187 VGDYQTNPLTKGIIEGYNTMDTLASLIFGMLIIDLLRKKGVDSPREQTKYLVRAAFIAAG 246

Query: 237 GLSLVYLALFYLGATSQGIAGDAQNGVQILTAYVQQTFGVSGSLLLAVVITLACLTTAVG 296
           GL+ VY++LFYLGAT+  +A  A NG  ILT YV   FG SG LLLA V+TLACLTT VG
Sbjct: 247 GLAFVYVSLFYLGATAGDLAVGADNGGVILTNYVNYQFGASGQLLLAAVVTLACLTTVVG 306

Query: 297 LITACGEFFSDLLP-VSYKTVVIVFSLFSLLVANQGLTQLISLSVPVLVGLYPLAIVLIA 355
           L++AC E+F++L+P +SYK +V+V S+   +VAN GL QLI++S+PVLV +YP+AI L+A
Sbjct: 307 LVSACAEYFNELMPSLSYKLLVVVMSVTCAVVANVGLAQLINISIPVLVTIYPVAIALVA 366

Query: 356 LSLFDRLWVSAPRVFVPVMIVALLFGIVDGLGAAKLNGWVPDVFAKLPLADQSLGWLLPV 415
           ++     +         V+ VAL+FGI+DGL AA +N     +F  +PL+ Q + WL+P 
Sbjct: 367 VTYLTERFAQPAFAHRMVLSVALVFGIIDGLKAAGVN---MSMFDVMPLSAQGMAWLIPT 423

Query: 416 SIALVLAVVCDRLLGK 431
           +I +   ++  R  G+
Sbjct: 424 AITIFACLMVKRPRGE 439


Lambda     K      H
   0.327    0.144    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 602
Number of extensions: 32
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 437
Length of database: 443
Length adjustment: 32
Effective length of query: 405
Effective length of database: 411
Effective search space:   166455
Effective search space used:   166455
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory