Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate 5208462 Shew_0974 spermidine/putrescine ABC transporter ATPase subunit (RefSeq)
Query= uniprot:Q1MCU3 (247 letters) >FitnessBrowser__PV4:5208462 Length = 378 Score = 119 bits (297), Expect = 1e-31 Identities = 73/236 (30%), Positives = 130/236 (55%), Gaps = 12/236 (5%) Query: 8 GQPLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGS 67 G+ LL++ V + ++RA+ V +++N+GEI +L+G +G+GKSTL+ + G + G Sbjct: 17 GEVLLKIERVSKLFDDVRAVDDVSLNINRGEIFALLGGSGSGKSTLLRMLAGFEKPTEGR 76 Query: 68 VVFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLD-----NLKHFAED 122 + +G+DIT MP +E + QS +FP MTV +N+ G D ++ ++ Sbjct: 77 IYLDGQDITDMPPYERPINMMFQS---YALFPHMTVAQNIAFGLKQDKMPKAEIEQRVKE 133 Query: 123 VEKIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGI 182 + K+ + P K + Q LSGG++Q +++ R+L RPKLLLLDEP L + + Sbjct: 134 MLKLVHMEPYAKRKPNQ----LSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRTQM 189 Query: 183 FEAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVR 238 + + EA G+T +V + A+ ++ R +M +G + +GS ++ +P R Sbjct: 190 QLEVVDILEAVGVTCVMVTHDQEEAMTMAERIAIMNDGWIAQTGSPMDIYESPANR 245 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 378 Length adjustment: 27 Effective length of query: 220 Effective length of database: 351 Effective search space: 77220 Effective search space used: 77220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory