Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate 5210164 Shew_2608 inner-membrane translocator (RefSeq)
Query= TCDB::Q8DQH9 (318 letters) >FitnessBrowser__PV4:5210164 Length = 357 Score = 147 bits (371), Expect = 4e-40 Identities = 97/301 (32%), Positives = 155/301 (51%), Gaps = 31/301 (10%) Query: 30 VLNLFYVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKSPTYGA 89 VL+ +++ + QI I A+GLN++VGF+GQ SLGH F GA+A+A + + S Sbjct: 45 VLDGYFLTLFIQISYLGIAALGLNILVGFTGQISLGHGAFFGFGAFASAWLNT-SFNIPV 103 Query: 90 FFGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGIL 149 F L G L G V ++ G+P R+KG YLA+ATL II+ F + G++G + Sbjct: 104 VFCIPLAGFLTMG-VGMMFGMPAARIKGLYLAIATLAAQFIIQDFFGRAEWFSGGSSGAM 162 Query: 150 GIP------NFTTWQMVYFF----VVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVN 199 P +F T YF +V I N +RS GR+ ++VR+ ++AE +GV Sbjct: 163 AAPVSLFGFDFDTDMSFYFIALFALVFMYIWGCNLMRSRDGRAFVAVRDHYLSAEIMGVK 222 Query: 200 TTKIKIIAFVFGAITASIAGSLQAGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIV 259 K ++++F + A I G+L A ++G V + +T + SI L +V+ GGLGSI G ++ Sbjct: 223 LNKYRLLSFGISSFYAGIGGALYAHYLGYVSSEGFTILMSIQFLAMVIIGGLGSIKGTLM 282 Query: 260 SAIVL-------------------GILNMLLQDVASVRMIIYALALVLVMIFRPGGLLGT 300 + + G L M+ +A ++ + L ++L +IF P GL Sbjct: 283 GVVFMVLLPEVLEGMVGLMKYTDYGNLPMVTDGLAYIKEMAIGLVIILFLIFEPEGLAHR 342 Query: 301 W 301 W Sbjct: 343 W 343 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 357 Length adjustment: 28 Effective length of query: 290 Effective length of database: 329 Effective search space: 95410 Effective search space used: 95410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory