GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mmsB in Shewanella loihica PV-4

Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate 5209194 Shew_1672 3-hydroxyisobutyrate dehydrogenase (RefSeq)

Query= SwissProt::P28811
         (298 letters)



>lcl|FitnessBrowser__PV4:5209194 Shew_1672 3-hydroxyisobutyrate
           dehydrogenase (RefSeq)
          Length = 299

 Score =  323 bits (828), Expect = 3e-93
 Identities = 174/300 (58%), Positives = 211/300 (70%), Gaps = 5/300 (1%)

Query: 1   MTDIAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEV 60
           M  +AF+GLGNMGGPMA NL+KAG+ V  FDL   A+  +VE+GA  A SA      A+V
Sbjct: 1   MNTVAFIGLGNMGGPMAVNLVKAGYTVKAFDLSQTALSHVVEEGAMQAPSACAAAAAADV 60

Query: 61  VISMLPAGQHVESLYLGDD---GLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLL 117
           VI+MLPAG+HV SLYLGD+   G++  VA   LLIDCSTI  E+AR VAE A  KGL  +
Sbjct: 61  VITMLPAGKHVRSLYLGDEQNKGIIDVVADGTLLIDCSTIDAESARFVAEQAKTKGLEFI 120

Query: 118 DAPVSGGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNML 177
           DAPVSGG  GA AGTL+FI GG    F +A+ VL  MG NIFHAG  GAGQVAKICNNML
Sbjct: 121 DAPVSGGTAGAAAGTLTFICGGSDTAFEQAQGVLNVMGANIFHAGGPGAGQVAKICNNML 180

Query: 178 LGILMAGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAG 237
           L +LM GT+E++ +G+ +GLDP VLSE+MK SSGGNW L+ YNP P VM   P+SNGY G
Sbjct: 181 LSVLMVGTSESIQMGIDHGLDPKVLSEIMKVSSGGNWTLDKYNPCPDVMENVPSSNGYQG 240

Query: 238 GFQVRLMNKDLGLALANAQAVQASTPLGALARNLFSLHAQADAEHEGLDFSSIQKLYRGK 297
           GF V LM KDLGL+   A    +STP+GALAR+L+  HA+    +   DFSSI + +  K
Sbjct: 241 GFMVDLMVKDLGLSQEAALLSNSSTPMGALARSLYVNHARQG--NGKRDFSSIFEQFNKK 298


Lambda     K      H
   0.317    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 326
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 298
Length of database: 299
Length adjustment: 27
Effective length of query: 271
Effective length of database: 272
Effective search space:    73712
Effective search space used:    73712
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate 5209194 Shew_1672 (3-hydroxyisobutyrate dehydrogenase (RefSeq))
to HMM TIGR01692 (mmsB: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01692.hmm
# target sequence database:        /tmp/gapView.10418.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01692  [M=288]
Accession:   TIGR01692
Description: HIBADH: 3-hydroxyisobutyrate dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                        -----------
   3.7e-127  409.6   8.6   4.2e-127  409.4   8.6    1.0  1  lcl|FitnessBrowser__PV4:5209194  Shew_1672 3-hydroxyisobutyrate d


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__PV4:5209194  Shew_1672 3-hydroxyisobutyrate dehydrogenase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  409.4   8.6  4.2e-127  4.2e-127       1     286 [.       6     294 ..       6     296 .. 0.98

  Alignments for each domain:
  == domain 1  score: 409.4 bits;  conditional E-value: 4.2e-127
                        TIGR01692   1 fiGlGnmGgpmaanllkaghavrvfdlsakaveelveaGaqaaasaaeaveeadvvitmlPagkhvesvyagde...g 75 
                                      fiGlGnmGgpma nl+kag++v++fdls +a+ ++ve+Ga  a+sa +a++ advvitmlPagkhv+s+y+gde   g
  lcl|FitnessBrowser__PV4:5209194   6 FIGLGNMGGPMAVNLVKAGYTVKAFDLSQTALSHVVEEGAMQAPSACAAAAAADVVITMLPAGKHVRSLYLGDEqnkG 83 
                                      9***********************************************************************973336 PP

                        TIGR01692  76 ilakvkkksllidsstidvdsarkvaeeaaakGavfldaPvsGGvggaraGtltfmvGgeaeefaraepvleamgkni 153
                                      i+  v+ ++llid+stid++sar vae+a++kG+ f+daPvsGG++ga+aGtltf+ Gg++ +f++a+ vl+ mg ni
  lcl|FitnessBrowser__PV4:5209194  84 IIDVVADGTLLIDCSTIDAESARFVAEQAKTKGLEFIDAPVSGGTAGAAAGTLTFICGGSDTAFEQAQGVLNVMGANI 161
                                      ****************************************************************************** PP

                        TIGR01692 154 vhaGdaGaGqaakiCnnlllgismiGvaealalgeklGldpkvlaeilskssGrcWsldtynPvPGvveqaPasngyk 231
                                      +haG+ GaGq+akiCnn+ll++ m+G++e++++g+  Gldpkvl+ei++ ssG +W+ld ynP P v+e++P+sngy+
  lcl|FitnessBrowser__PV4:5209194 162 FHAGGPGAGQVAKICNNMLLSVLMVGTSESIQMGIDHGLDPKVLSEIMKVSSGGNWTLDKYNPCPDVMENVPSSNGYQ 239
                                      ****************************************************************************** PP

                        TIGR01692 232 gGfatalmlkdlglaqeaaksvkasvllGalarelyslfaskgagkkdfsavikl 286
                                      gGf ++lm+kdlgl+qeaa   ++s+++Galar ly  +a +g gk+dfs++++ 
  lcl|FitnessBrowser__PV4:5209194 240 GGFMVDLMVKDLGLSQEAALLSNSSTPMGALARSLYVNHARQGNGKRDFSSIFEQ 294
                                      ****************************************************975 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (288 nodes)
Target sequences:                          1  (299 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.01
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory