Align 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 (characterized)
to candidate 5209346 Shew_1820 2-methylisocitrate lyase (RefSeq)
Query= SwissProt::Q8EJW1 (292 letters) >FitnessBrowser__PV4:5209346 Length = 292 Score = 417 bits (1073), Expect = e-121 Identities = 209/289 (72%), Positives = 241/289 (83%) Query: 4 SAGLRFRQALANSKPLQIVGTTNAYFALMAEQTGFQALYLSGAGVANASYGLPDLGMTSM 63 SAG +FRQALA++KPLQIVGT NAY A+MA+Q G +A+YLSG GVANASYGLPDLGMTS+ Sbjct: 2 SAGKKFRQALADNKPLQIVGTINAYTAMMAKQIGHKAIYLSGGGVANASYGLPDLGMTSL 61 Query: 64 NDVLIDAGRITSATQLPLLVDIDTGWGGAFNIARTIKEFEKIGVAAVHMEDQVSQKRCGH 123 NDV++D RITSA LPLLVDIDTGWGGAFNIA+TIK+ EK G AAVHMEDQV+QKRCGH Sbjct: 62 NDVIVDVQRITSACDLPLLVDIDTGWGGAFNIAKTIKDMEKAGAAAVHMEDQVAQKRCGH 121 Query: 124 RPNKAVVSTEEMVDRIKAAVDARTDPNFVIMARTDAVAVEGLEAGIERAKAYIAAGADMI 183 RPNK +VS EEMVDRIKAAVDARTDP+F IMARTDA A EGLEA IERAKAY+AAGAD I Sbjct: 122 RPNKEIVSVEEMVDRIKAAVDARTDPDFFIMARTDAFAQEGLEAAIERAKAYVAAGADGI 181 Query: 184 FAEALTELDQYRHFKAQVKAPILANMTEFGQTQLFNKEELAQAGADMVLYPLGTFRAANQ 243 FAEA+ + YR F + PILAN+TEFGQT+L+N+E+L Q GA MVLYPL FRA N+ Sbjct: 182 FAEAVKTEEHYRAFAEALDVPILANITEFGQTELWNREQLGQWGAAMVLYPLSAFRAMNK 241 Query: 244 AALKVMQALMNDGHQRNVLDTMQTRADLYKYLGYHAFEDKLDQLFSQDK 292 AA V Q ++ DG Q+ VLDTMQTR +LY YLGYHA+E KLD LF++ K Sbjct: 242 AAENVYQTILRDGDQKAVLDTMQTRMELYDYLGYHAYEQKLDSLFAEGK 290 Lambda K H 0.319 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 292 Length adjustment: 26 Effective length of query: 266 Effective length of database: 266 Effective search space: 70756 Effective search space used: 70756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate 5209346 Shew_1820 (2-methylisocitrate lyase (RefSeq))
to HMM TIGR02317 (prpB: methylisocitrate lyase (EC 4.1.3.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02317.hmm # target sequence database: /tmp/gapView.24796.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02317 [M=285] Accession: TIGR02317 Description: prpB: methylisocitrate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-133 427.8 3.7 1e-132 427.6 3.7 1.0 1 lcl|FitnessBrowser__PV4:5209346 Shew_1820 2-methylisocitrate lya Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209346 Shew_1820 2-methylisocitrate lyase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 427.6 3.7 1e-132 1e-132 2 284 .. 4 287 .. 3 288 .. 0.99 Alignments for each domain: == domain 1 score: 427.6 bits; conditional E-value: 1e-132 TIGR02317 2 gkalrellkkedilqipGainalvallaekaGfeavYlsGaalaa.slglPDlglttleevaeearritrvtklpllv 78 gk++r++l+ +++lqi+G+ina++a++a++ G++a+YlsG+++a+ s glPDlg+t+l++v+ +++rit++++lpllv lcl|FitnessBrowser__PV4:5209346 4 GKKFRQALADNKPLQIVGTINAYTAMMAKQIGHKAIYLSGGGVANaSYGLPDLGMTSLNDVIVDVQRITSACDLPLLV 81 799*****************************************989******************************* PP TIGR02317 79 DaDtGfGealnvartvkeleeagvaavhieDqvapkkCGhldgkelvskeemvkkikaavkakkdedfvliaRtDara 156 D+DtG+G+a+n+a+t+k++e+ag+aavh+eDqva+k+CGh+++ke+vs eemv++ikaav+a++d+df+++aRtDa a lcl|FitnessBrowser__PV4:5209346 82 DIDTGWGGAFNIAKTIKDMEKAGAAAVHMEDQVAQKRCGHRPNKEIVSVEEMVDRIKAAVDARTDPDFFIMARTDAFA 159 ****************************************************************************** PP TIGR02317 157 veGldaaieRakaYveaGadaiftealeseeefrefakavkvpllanmtefGktplltadeleelgykiviyPvtalR 234 +eGl+aaieRakaYv aGad if+ea+++ee++r fa+a++vp+lan+tefG+t l++ ++l + g ++v+yP++a+R lcl|FitnessBrowser__PV4:5209346 160 QEGLEAAIERAKAYVAAGADGIFAEAVKTEEHYRAFAEALDVPILANITEFGQTELWNREQLGQWGAAMVLYPLSAFR 237 ****************************************************************************** PP TIGR02317 235 aalkaaekvyeelkkkGtqkelldklqtRkelYellgyedyekkdkelfk 284 a++kaae+vy+++ ++G qk++ld++qtR elY+ lgy++ye+k+++lf+ lcl|FitnessBrowser__PV4:5209346 238 AMNKAAENVYQTILRDGDQKAVLDTMQTRMELYDYLGYHAYEQKLDSLFA 287 **********************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.05 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory