Align lactaldehyde dehydrogenase (EC 1.2.1.22); D-glyceraldehyde dehydrogenase (NADP+) (EC 1.2.1.89) (characterized)
to candidate 5208455 Shew_0967 aldehyde dehydrogenase (RefSeq)
Query= BRENDA::P25553 (479 letters) >FitnessBrowser__PV4:5208455 Length = 498 Score = 251 bits (641), Expect = 4e-71 Identities = 153/483 (31%), Positives = 260/483 (53%), Gaps = 9/483 (1%) Query: 2 SVPVQHPMYIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERA--QPE 59 S+ +Q +I+G++ + D ++P V++++ DA +A+ A + + Sbjct: 16 SLVIQGQAFINGEYCAADSNDTFDCISPIDGRVLTQVASCDLLDANRAVANAREVFERGD 75 Query: 60 WEALPAIERASWLRKISAGIRERASEISALIVEEGGK-IQQLAEVEVAFTADYIDYMAEW 118 W LP ++R + + + + E++ L + GK I+ V+VA A + + E Sbjct: 76 WSQLPPVKRKQVMIRFADLLEANRDELALLETLDMGKPIRYSGAVDVAGAARALRWSGEA 135 Query: 119 ARRYEGEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPS 178 + EI + E ++ + +GV I+PWNFP + K+ PAL TGN++V+KPS Sbjct: 136 VDKIYDEIAPTAH-NEIGMITREPVGVVAAIVPWNFPLLMACWKLGPALATGNSVVLKPS 194 Query: 179 EFTPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIM 238 E +P AI A++ E G+P+GV N++ G G TVG+ LA + V + TGS +++M Sbjct: 195 EKSPLTAIRMAQLAIEAGIPKGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLM 254 Query: 239 ATAAK-NITKVCLELGGKAPAIVMDDA-DLELAVKAIVDSRVINSGQVCNCAERVYVQKG 296 A + N+ +V LE GGK+P IV +DA +L+ A A + N G+VC R+ V+ G Sbjct: 255 IYAGESNMKRVWLEAGGKSPNIVFNDAPNLKEAAIAAASAIAFNQGEVCTAGSRLLVESG 314 Query: 297 IYDQFVNRLGEAMQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVAFGGK 356 + ++ +N + MQA Q G+P + G +++ LE V + + V EGA++ GG+ Sbjct: 315 VKEELINLIEAEMQAWQPGHPLD-PATTCGAVVDQQQLENVLRYIRAGVAEGAQLRQGGQ 373 Query: 357 AV--EGKGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSS 414 V E G Y PT+ +V+ EM+I EE FGPVL V+ FD +E+AI + ND+ YGL + Sbjct: 374 QVLAETGGVYVAPTIFANVKNEMTIAKEEIFGPVLSVITFDGMEEAIRIGNDTIYGLAAG 433 Query: 415 IYTQNLNVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQV 474 ++T +++ A K K L+ G +IN + M G+++SG G H +Y + + Sbjct: 434 VWTSDISKAHKTAKALRSGMVWINHYDGGDMTAPFGGYKQSGNGRDKSLHAFDKYTEIKA 493 Query: 475 VYL 477 ++ Sbjct: 494 TWI 496 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 538 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 498 Length adjustment: 34 Effective length of query: 445 Effective length of database: 464 Effective search space: 206480 Effective search space used: 206480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory