GapMind for catabolism of small carbon sources

 

Aligments for a candidate for hcl in Pedobacter sp. GW460-11-11-14-LB5

Align Benzoate--CoA ligase; Benzoyl-CoA synthetase; EC 6.2.1.25 (characterized)
to candidate CA265_RS16340 CA265_RS16340 acetate--CoA ligase

Query= SwissProt::Q8GQN9
         (527 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS16340 CA265_RS16340
           acetate--CoA ligase
          Length = 631

 Score =  149 bits (376), Expect = 3e-40
 Identities = 148/549 (26%), Positives = 239/549 (43%), Gaps = 50/549 (9%)

Query: 21  RYNAADDLIGRNLLAGRGGKTVYI-------DDAGSYTYDELALRVNRCGSALRTTLGLQ 73
           + N  ++ + R+L A  G K   +       +++ +YTY  L  RV R  + L+   G +
Sbjct: 57  KLNITENCLDRHL-ATNGDKPAIVWEPNNPEEESVTYTYKMLHERVCRFANVLKRN-GAK 114

Query: 74  PKDRVLVCVLDGIDFPTTFLGAIKGGVVPIAINTLLTESDYEYMLTDSAARVAVVSQ--- 130
             DR+ + +    +     L   + G V   I    +       + DS  +V + +    
Sbjct: 115 KGDRICIYMPMVPELAIAVLACARIGAVHSVIFGGFSAKSIADRINDSKCKVVITADGSY 174

Query: 131 ------ELLPLFAPMLGKVPTLEHLVVAGGAG-------------EDSLAALLATGSEQF 171
                  L  +    L   PT+E  +V                  ED +  +    ++  
Sbjct: 175 RGNKQIPLKDVIDDALIGCPTVEKCIVLTHIRTPVSMLKGRDVWWEDEVKHV----NDIC 230

Query: 172 EAAPTRPDDHCFWLYSSGSTGAPKGTVHIHSDLIHTAELYARPILGIREGDVVFSAAKLF 231
           EA     +D  F LY+SGSTG PKG VH     +  A      +   + G+V F  A + 
Sbjct: 231 EAEEMDAEDMLFILYTSGSTGKPKGVVHTCGGYMVYAGYTFSNVFNYQPGEVYFCTADIG 290

Query: 232 FAYGLGNGLIFPLAVGATAVL---MAERPTPAAVFERLRRHQPDIFYGVPTLYASMLANP 288
           +  G    +  PL+ GAT+VL   +   PTP+  ++ + +H+ +  Y  PT   S+++  
Sbjct: 291 WITGHSYIVYGPLSQGATSVLFEGIPTYPTPSRFWDIVEKHKVNTLYTAPTAIRSLMSYG 350

Query: 289 DCPKEGE--LRLRACTSAGEALPEDVGRRWQARFG---VDILDGIGSTEMLHIFLSNRAG 343
           D P  G+    +R   S GE + E+    +  + G     I+D    TE   I +S  A 
Sbjct: 351 DDPLNGKDLSSIRVLGSVGEPINEEAWHWFDEKIGHGKAPIVDTWWQTETGGIMISPIAT 410

Query: 344 DVHYGTSGK--PVPGYRLRLIDEDGAEITTAGVAGELQISGPSSAVMY--WNNPEKTAAT 399
                 S    P+PG +  L+DE+G EI   GV G L I  P   ++   + + E+   T
Sbjct: 411 VTPTKPSFATLPLPGIQPILVDENGNEIEGNGVMGNLCIKFPWPGMLRTTYGDHERCKQT 470

Query: 400 FMGEWTR---SGDKYLVNDEGYYVYAGRSDDMLKVSGIYVSPIEVESALIAHEAVLEAAV 456
           +   +     +GD  L +++GYY   GR DD+L VSG  +   EVE+A+  H  V+E+AV
Sbjct: 471 YFSTYDNLYFTGDGCLRDEDGYYRITGRVDDVLNVSGHRIGTAEVENAINMHAGVVESAV 530

Query: 457 VGWEDEDHLIKPKAFIVLKPGYGAGEALRTDLKAHVKNLLAPYKYPRWIEFVDDLPKTAT 516
           VG+  +       AF++    +G  E  + D+   V  ++     P  I FV  LPKT +
Sbjct: 531 VGYPHDVKGQGIYAFVIYPEMHGEAELSKKDILQTVTRVIGAIAKPDKILFVSGLPKTRS 590

Query: 517 GKIQRFKLR 525
           GKI R  LR
Sbjct: 591 GKIMRRILR 599


Lambda     K      H
   0.319    0.138    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 893
Number of extensions: 47
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 527
Length of database: 631
Length adjustment: 36
Effective length of query: 491
Effective length of database: 595
Effective search space:   292145
Effective search space used:   292145
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory