Align 4-hydroxybenzoyl-CoA reductase HbaD subunit (EC 1.3.7.9) (characterized)
to candidate CA265_RS09865 CA265_RS09865 FAD-binding molybdopterin dehydrogenase
Query= metacyc::MONOMER-17405 (327 letters) >FitnessBrowser__Pedo557:CA265_RS09865 Length = 327 Score = 118 bits (296), Expect = 2e-31 Identities = 89/278 (32%), Positives = 136/278 (48%), Gaps = 23/278 (8%) Query: 10 LRPGSVDEAIAALLAHPGGWLLGGGTDLLVNMRRGVTQPETLIDTTGIAEIKQLVADGSG 69 LR + AIA L+ L GGT+L+ M+RGVT PE LID + +KQ+ G+ Sbjct: 7 LRTTTAKSAIALLVKDKNAKFLAGGTNLIDLMKRGVTAPEKLIDINHVP-LKQIEQIGNK 65 Query: 70 LTIGAGVTLASLAADGLVAARYPALSEAARAVAGPGHRKLGTVGGNLCLDTRCIYYNQSE 129 + IGA + ++A L+ + P LS A +A A R + TVGGN+ TRC Y+ +E Sbjct: 66 IHIGALASNTAVADHALIKEKLPLLSWALQAGASAQLRNVATVGGNMMQRTRCGYFYDTE 125 Query: 130 WWRRANSYCLKNR-GEICHVAPKGNRCHAAFS----------GDLAPALLVLGAEVEIAG 178 C K + G C NR HA F D+ AL+ L AEV +A Sbjct: 126 ------MPCNKRQPGTGCGAMEGFNRMHAIFGTSEKCIAVHPSDMCVALVALDAEVILAN 179 Query: 179 PDGRRRIPLGE---LYVEDGRAHLALRPGEVVVTVRLPADPLAS--RYVKVRQRGAIDYP 233 G R++P E L + + L+ E+++ + +P + LA Y+KVR R + + Sbjct: 180 AKGERKMPFKEFHRLVGDTPQLDNNLKVDEMIIRLEIPVNNLAKNYHYLKVRDRASYAFA 239 Query: 234 LAGVAVALARSGSRLAQLRIALTGTNSRPFLLAETAAF 271 L VA A S +++ +R+A+ G +P+ L + F Sbjct: 240 LVSVAAAFEISNNKITDVRLAMGGVAHKPWRLTASENF 277 Lambda K H 0.321 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 327 Length adjustment: 28 Effective length of query: 299 Effective length of database: 299 Effective search space: 89401 Effective search space used: 89401 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory