Align 4-hydroxybenzoyl-CoA reductase, γ subunit (EC 1.3.7.9) (characterized)
to candidate CA265_RS09870 CA265_RS09870 2Fe-2S ferredoxin
Query= metacyc::MONOMER-14378 (158 letters) >FitnessBrowser__Pedo557:CA265_RS09870 Length = 207 Score = 139 bits (350), Expect = 3e-38 Identities = 72/154 (46%), Positives = 95/154 (61%) Query: 2 KTLLTLSVNGRPREDAVAGNALLIDYLRDTLGLTGTKQGCDGGECGACTVLVDGQPRLAC 61 K L L+VN + + V L+DYLR+ L LTGTK+GCD G+CGACTV VDGQ +C Sbjct: 52 KIPLKLTVNNKAYQTTVEPRVTLLDYLREELHLTGTKKGCDHGQCGACTVHVDGQRVNSC 111 Query: 62 CTLAHSVAGHSIETIEGLSHEGNLSRLQRAFHEHLGSQCGFCTPGMIMAAEALLRRNPQP 121 +LA G I TIEGL++ L +Q AF +H G QCG+CTPG IM+A A +R Sbjct: 112 LSLAVMNEGKKITTIEGLANGDTLHPMQAAFIKHDGFQCGYCTPGQIMSAVACVREGHTG 171 Query: 122 SRDEIRAALAGNLCRCTGYVKIIESVEAAACGSE 155 SR EI ++GN+CRC Y I++++ G E Sbjct: 172 SRAEISEYMSGNICRCGAYPNIVDAIIEVKEGGE 205 Lambda K H 0.320 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 158 Length of database: 207 Length adjustment: 19 Effective length of query: 139 Effective length of database: 188 Effective search space: 26132 Effective search space used: 26132 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory