Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate CA265_RS06590 CA265_RS06590 acetyl-CoA acetyltransferase
Query= metacyc::MONOMER-3207 (400 letters) >FitnessBrowser__Pedo557:CA265_RS06590 Length = 391 Score = 256 bits (655), Expect = 6e-73 Identities = 161/401 (40%), Positives = 233/401 (58%), Gaps = 11/401 (2%) Query: 1 MRDVFICDAIRTPIGRFGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQA 60 M++V I A+RTPIG FGG+LA A L +KA IE ++ +Q+ EV+ G A Sbjct: 1 MKEVVIVSAVRTPIGSFGGSLAQFSATQLGGFAIKAAIE-KAGLKPEQIQEVYMGNVLSA 59 Query: 61 GEDNRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESM 120 + A A AGLP+ +P T+N++CASG AI A ++IA+G+ E+ +AGG+ESM Sbjct: 60 NL-GQAPATQAAKFAGLPD-LPATTINKVCASGTKAIMLAAQSIANGDNEIIVAGGMESM 117 Query: 121 SRAPFVMGKAESGYSRNMKLEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRAD 180 S P+ + KA +GY +L I + + Y M A+ A + ++R Sbjct: 118 SNVPYYLDKARNGY----RLGHGQITDGLVKDGLWDVYNDYHMGSAAELCATECNINREA 173 Query: 181 QDAFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGE-TIVERDEHLRPETTLEALTKLKP 239 QD FA+ S ++A AAQ +G FA EIV + + +KG+ T+V+ D+ + + LKP Sbjct: 174 QDNFAISSYKRAQAAQTSGKFANEIVAIEVKDRKGDITLVDTDDE-PTAVKFDKIPSLKP 232 Query: 240 VNGPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLGMASGGVAPRVMGIGPV 299 V D TVTA NAS +NDGAAAL+L SA+ K+ GLTP A++LG A AP P Sbjct: 233 VFKKDGTVTAANASTLNDGAAALVLMSADKAKELGLTPLAKILGYADAQQAPEWFTTAPS 292 Query: 300 PAVRKLTERLGVAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLG 359 A+ + V ++D D E+NEAFA +A + L + D+ QVN NGGA++LGHPLG Sbjct: 293 KAIPLALHKANVNINDVDFFEINEAFAVVSIANNQLLALNDN--QVNVNGGAVSLGHPLG 350 Query: 360 MSGARLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIERV 400 SGAR+V+T L L ++ G+ G+A +C G G AL I ++ Sbjct: 351 ASGARIVVTLLSVLAQNDGKIGVAGICNGGGGASALVIGKL 391 Lambda K H 0.318 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 391 Length adjustment: 31 Effective length of query: 369 Effective length of database: 360 Effective search space: 132840 Effective search space used: 132840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory