GapMind for catabolism of small carbon sources

 

Alignments for a candidate for xylF in Pedobacter sp. GW460-11-11-14-LB5

Align 2-hydroxymuconate-6-semialdehyde hydrolase (EC 3.7.1.9) (characterized)
to candidate CA265_RS12370 CA265_RS12370 alpha/beta hydrolase

Query= BRENDA::G3KFX4
         (282 letters)



>FitnessBrowser__Pedo557:CA265_RS12370
          Length = 291

 Score = 81.3 bits (199), Expect = 2e-20
 Identities = 47/131 (35%), Positives = 74/131 (56%), Gaps = 3/131 (2%)

Query: 2   NAPQQSPEIGREILAAGYRTNLHDQGEGFPVLLIHGSGPGVTAWANWRLVMPQLAQNRRV 61
           NA Q  P     +   G +      G+G PV+L+HG+   +T  ANW  ++PQL++ R+V
Sbjct: 28  NAQQGKPNGSGFVPVNGIKVYYETYGQGKPVILLHGAF--MTIEANWGQLIPQLSKTRKV 85

Query: 62  IAPDMLGFGYSDRPADGRYHQQRWVEHAIGVLDALGIQQADIVGNSFGGGLALALAIRHP 121
           IA ++ G G+S   +D +           GV+D L I  AD++G SFGG +A   AI+ P
Sbjct: 86  IAIELQGHGHSPF-SDRKLSHVTLASDVAGVMDYLKIDSADVIGYSFGGSVAYQFAIQSP 144

Query: 122 ERVRRLVLMGS 132
           +R+ +LV++ S
Sbjct: 145 KRLGKLVIISS 155


Lambda     K      H
   0.323    0.138    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 201
Number of extensions: 11
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 282
Length of database: 291
Length adjustment: 26
Effective length of query: 256
Effective length of database: 265
Effective search space:    67840
Effective search space used:    67840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory