Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate CA265_RS04175 CA265_RS04175 phosphonate ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >FitnessBrowser__Pedo557:CA265_RS04175 Length = 232 Score = 139 bits (350), Expect = 5e-38 Identities = 83/223 (37%), Positives = 129/223 (57%), Gaps = 8/223 (3%) Query: 14 IIQMQGVNKWYGQFHV----LKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEEHQQG 69 +I+++ + K Y V L INL+V GE + + GPSG GKST + + L++ + G Sbjct: 1 MIKIENLEKVYKTEEVETTALNGINLHVAAGEFVSIMGPSGCGKSTLLNVMGLLDKPENG 60 Query: 70 RIVVDGVELT--NDLKQIEAIRREVGMVFQHFNLFPHLTILQNCTLAPMWVRKMPKRKAE 127 EL ND ++ +R +G VFQ+FNL LT+ +N L P+ K+P + + Sbjct: 61 SYKFIDTELLTLNDRERSNFRKRNMGFVFQNFNLIDELTVFENIEL-PLIYNKIPAGERK 119 Query: 128 EIAMHYLERVRIPEQAHKYPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPEMVKE 187 ++ +ER+ I ++ +P QLSGGQQQRVA+ARAL KPK++L DEPT LD E Sbjct: 120 KLVNEIIERMNIVNRSGHFPQQLSGGQQQRVAVARALVTKPKLVLADEPTGNLDSSHGNE 179 Query: 188 VLDTMIGLAEDGMTMLCVTHEMGFARTVANRVIFMDKGEIVEQ 230 V++ + L E G T++ VTH A + +NR+I + G ++ + Sbjct: 180 VMELLCELNETGTTIVMVTHSSHDA-SFSNRIINLKDGHVISE 221 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 232 Length adjustment: 23 Effective length of query: 231 Effective length of database: 209 Effective search space: 48279 Effective search space used: 48279 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory