Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate CA265_RS04345 CA265_RS04345 lipoprotein-releasing system ATP-binding protein LolD
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >FitnessBrowser__Pedo557:CA265_RS04345 Length = 216 Score = 130 bits (326), Expect = 3e-35 Identities = 79/220 (35%), Positives = 124/220 (56%), Gaps = 9/220 (4%) Query: 14 IIQMQGVNKWYGQFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEEHQQGRIVV 73 +++ G+ K YG +LK +N V++GE + + GPSG+GKST + L L++ G + + Sbjct: 1 MLKATGIRKSYGNLQILKGVNFEVQKGEIVSIIGPSGAGKSTLLHILGTLDKPDDGSVQL 60 Query: 74 DGV---ELTNDLKQIEAIRRE-VGMVFQHFNLFPHLTILQNCTLAPMWVRKMPKRKAEEI 129 G +L DL + R + +G VFQ +L P + ++N + P ++ K K++AE Sbjct: 61 KGTVINKLNGDL--LSTFRNQNIGFVFQFHHLLPEFSAIENICI-PAFIAKTNKKQAETR 117 Query: 130 AMHYLERVRIPEQAHKYPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPEMVKEVL 189 A L+ + ++A P QLSGG+QQRVAIARAL P I+L DEP+ LD E + Sbjct: 118 AFELLDLFGLKDRAQHKPNQLSGGEQQRVAIARALINNPSIILADEPSGNLDSENAAGLH 177 Query: 190 DTMIGLAED-GMTMLCVTHEMGFARTVANRVIFMDKGEIV 228 + L ++ T + VTH A+T ++RV+ M G IV Sbjct: 178 QLFVSLRDNFHQTFVIVTHNEHLAKT-SDRVVSMKDGLIV 216 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 216 Length adjustment: 23 Effective length of query: 231 Effective length of database: 193 Effective search space: 44583 Effective search space used: 44583 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory