Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.110) (characterized)
to candidate CA265_RS08865 CA265_RS08865 electron transfer flavoprotein subunit alpha
Query= BRENDA::H6LBB1 (418 letters) >FitnessBrowser__Pedo557:CA265_RS08865 Length = 322 Score = 168 bits (426), Expect = 2e-46 Identities = 101/321 (31%), Positives = 170/321 (52%), Gaps = 6/321 (1%) Query: 74 ITVYVDHIEGQIHPVTFELIGKARELAAVIGHPVYALLMGTNITEKADELLKYGVDKVFV 133 + VYV+ EG+ FE + A+ +A + A+ +G + EL KYG KV Sbjct: 3 VLVYVEQAEGKFKKSVFEAVSYAKAIADQQSTQLTAISIGDVADSELKELGKYGASKVLN 62 Query: 134 YDKPELKHFVIEPYANVLEDFIEKVKPSSILVGATNVGRSLAPRVAARYRTGLTADCTIL 193 +LK FV + YA+V+ EK +++ + G+ LAPR+A + + GL L Sbjct: 63 VSSDQLKTFVNQAYASVIAAAAEKEGADIVVLSNSFSGKGLAPRIAVKLKAGLADGAVEL 122 Query: 194 EMKENTDLVQIRPAFGGNIMAQIVTENTRP-QFCTVRYKVFTAPERVNEPWGDVEMMDIE 252 + V+ + AF G A +TE T + + F E + +V D++ Sbjct: 123 PSNDGKFSVK-KTAFSGKAFA--ITELTSANKVIALNPNAFGVKENATDAAIEVFTADVK 179 Query: 253 KAKLVSAIEVMEVIKKEKGIDLSEAETIVAVGRGVKCEKDLDMIHEFAEKIGATVACTRP 312 ++ L + I+ E+++ + L +AE +V+ GRG+K ++ MI E A +GA AC++P Sbjct: 180 QSDLGTVIK--EIVRATDKVSLPDAELVVSAGRGLKGPENWGMIEELAGLLGAATACSKP 237 Query: 313 GIEAGWFDARLQIGLSGRTVKPKLIIALGISGAVQFAAGMQNSEYIIAINSDPKAPIFNI 372 +A W +G +G + P L IA+GISGA+Q AG+ +S+ I+ IN DP+AP F + Sbjct: 238 VSDADWRPHSEHVGQTGIAISPNLYIAIGISGAIQHLAGVSSSKVIVVINKDPEAPFFKV 297 Query: 373 AHCGMVGDLYEILPELLTMIE 393 A G+VGD +E++P+L+ ++ Sbjct: 298 ADYGIVGDAFEVVPKLIEALK 318 Lambda K H 0.319 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 322 Length adjustment: 30 Effective length of query: 388 Effective length of database: 292 Effective search space: 113296 Effective search space used: 113296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory