Align Uncharacterized lactate 2-monooxygenase PB1A11.03; EC 1.13.12.4 (characterized)
to candidate CA265_RS08335 CA265_RS08335 alpha-hydroxy-acid oxidizing enzyme
Query= SwissProt::Q9HDX2 (407 letters) >FitnessBrowser__Pedo557:CA265_RS08335 Length = 389 Score = 177 bits (449), Expect = 5e-49 Identities = 112/348 (32%), Positives = 178/348 (51%), Gaps = 26/348 (7%) Query: 43 AVERMTKDAAGYVYGCAGKRETYDKNMESFKKWSIIPNRLIKSGFPDLSTTVFGQKYPFP 102 A R+ K A Y+ G + +N F + PN L G D+S +FG++Y P Sbjct: 23 AKSRIPKFAFDYLEGGCNEGLNLSRNESDFDNIYLKPNYLRVGGDIDMSVELFGRRYSAP 82 Query: 103 IALAPVGVQKIFNPEGESGSCAAATREHIPYIISTASATSFEDIEKASGPGERWYQLYWP 162 ++P+G+Q + P AA + IPY +ST S +S E I + S G+ W+QLY P Sbjct: 83 FGISPIGLQGLMWPNAPEILARAAAKADIPYTLSTVSTSSIERIAEVS-EGKAWFQLYHP 141 Query: 163 SNDHQDITISLLNRAKKTGCRVLIVTLDTFILGWRPSDMDNGYD--PFLNPDSI------ 214 + D + +LNR K C VL+V +D G R ++ +G P ++ ++I Sbjct: 142 TEDR--LRDDILNRLKAVECPVLVVLVDVPAFGLRYKEIKSGLSIPPKMSINNILQAFAR 199 Query: 215 ------GVEHGFSDPVFRKQFKEKHGVEVEENMLEAAKEFAGIVFPGISHDWEDLKFLRK 268 ++HG K + EK G+++ + + F G V D E + +R Sbjct: 200 PLWGIKTLQHGIPSFATLKPYMEK-GMDMSQLGQFMNRTFTGKV------DIEKVSAIRD 252 Query: 269 HWDGPIVLKGIMNVPDAKKAVEYGMQGIVVSNHGGRQQDGGVASLTMLPKIVD--AVGDK 326 W GP++LKGI D + A++ G G++VSNHGGRQ D G +S+ L K+ + K Sbjct: 253 LWKGPLILKGITTDEDMQAAIQIGADGVIVSNHGGRQIDAGESSINSLIKMTNNPIYKSK 312 Query: 327 LDVLFDSGVRSGADIAKALALGAKMVLIGRPYVYGLALEGSSGVSHVI 374 L ++ D G+RSG D+A+A A+G++ +GRP++YG+ G+ G H I Sbjct: 313 LKIMLDGGIRSGVDLARAHAVGSEFNFMGRPFMYGVGALGNEGGDHTI 360 Lambda K H 0.319 0.138 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 407 Length of database: 389 Length adjustment: 31 Effective length of query: 376 Effective length of database: 358 Effective search space: 134608 Effective search space used: 134608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory