Align N-acetylglucosamine 6-phosphate deacetylase (NagA) (EC 3.5.1.25) (characterized)
to candidate CA265_RS18930 CA265_RS18930 N-acetylglucosamine-6-phosphate deacetylase
Query= CAZy::BAA22834.1 (378 letters) >FitnessBrowser__Pedo557:CA265_RS18930 Length = 363 Score = 239 bits (609), Expect = 1e-67 Identities = 136/372 (36%), Positives = 209/372 (56%), Gaps = 16/372 (4%) Query: 4 LTNCKIYTGNDVLVKHAVIINGDKIEAVCPIESLPSEMNVVDLNGANLSPGFIDLQLNGC 63 +TN + N++ ++I G I + E+ + ++ PGFIDLQ+ G Sbjct: 5 ITNTSYFQDNEIKSNQDILIEGSTISIINSSENKETSQSLT-------IPGFIDLQIYGA 57 Query: 64 GGVMFNDEITAETIDIMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKYPNQSL 123 G +F+ + T E++ IM LK G T FL + T+S E I AA+E+++ N L Sbjct: 58 AGRLFSADPTVESLTIMEDDLLKKGTTGFLACMATNSSEVFNACIKAAKEHRSAAKN-CL 116 Query: 124 GLHLEGPYLNVMKKGIHSVDFIRPSD-DTMIDTICANSDVIAKVTLAPENNKPEHIEKLV 182 GLHLEGP+LN + G H F+R + D + + I VI +T+APE E I+ L+ Sbjct: 117 GLHLEGPFLNPKRLGAHVPAFVRKASLDEIKELIDFGDGVIKMMTIAPEIQDDEVIQYLL 176 Query: 183 KAGIVVSIGHTNATYSEARKSFESGITFATHLFNAMTPMVGREPGVVGAIYDTPEVYAGI 242 G+VVS+GH+NAT+ EA ++ GI THLFNAM+P+ REPG+ A+++ + A I Sbjct: 177 DHGVVVSLGHSNATFDEATAAYNKGIQTTTHLFNAMSPIHHREPGIPTAVFNHNKAMASI 236 Query: 243 IADGFHVDYANIRIAHKIKGEKLVLVTDATAPAGAEMDYFIFVGKKVYYRDGKCVDENGT 302 IADG HVD+ ++ A K+ E+L L+TDA + ++ K V +GT Sbjct: 237 IADGQHVDFEVLKFAQKLLKERLFLITDAVTACSTGPYQHV-------EKENKYVMPDGT 289 Query: 303 LGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKKGMIANLTVFDR 362 L GS++TM++AV+N V H I+L + ++M TLYPA+ IG++ I G ANL V D Sbjct: 290 LSGSSITMLQAVKNCVTHCAISLSDGVKMGTLYPAQLIGIENLTATIATGHQANLLVLDD 349 Query: 363 DFNVKATVVNGQ 374 + ++K + G+ Sbjct: 350 ELSLKEVIFRGE 361 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 363 Length adjustment: 30 Effective length of query: 348 Effective length of database: 333 Effective search space: 115884 Effective search space used: 115884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate CA265_RS18930 CA265_RS18930 (N-acetylglucosamine-6-phosphate deacetylase)
to HMM TIGR00221 (nagA: N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00221.hmm # target sequence database: /tmp/gapView.1766586.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00221 [M=380] Accession: TIGR00221 Description: nagA: N-acetylglucosamine-6-phosphate deacetylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-97 313.0 2.5 1.6e-97 312.8 2.5 1.1 1 lcl|FitnessBrowser__Pedo557:CA265_RS18930 CA265_RS18930 N-acetylglucosamin Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS18930 CA265_RS18930 N-acetylglucosamine-6-phosphate deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 312.8 2.5 1.6e-97 1.6e-97 6 379 .. 4 360 .. 1 361 [. 0.93 Alignments for each domain: == domain 1 score: 312.8 bits; conditional E-value: 1.6e-97 TIGR00221 6 llkdkailtendvlddsavvindekikavvteaeleeeikeidlkgnvltpGliDvqlnGcgGvdtnd 73 ++++++ + +n++ ++ ++i++ i+ + +++++e+ + pG+iD+q+ G+ G + lcl|FitnessBrowser__Pedo557:CA265_RS18930 4 VITNTSYFQDNEIKSNQDILIEGSTISIINSSENKET-------SQSLTIPGFIDLQIYGAAGRLFSA 64 578889999999999999***9999987766555543.......346678**************9975 PP TIGR00221 74 .asvetleimsealaksGvtsfLptlitredeeikkavkvareylakeknakiLGlhleGPflslekk 140 +ve+l im++ l k+G+t+fL+ + t++ e + +k+a+e+ ++ kn LGlhleGPfl++++ lcl|FitnessBrowser__Pedo557:CA265_RS18930 65 dPTVESLTIMEDDLLKKGTTGFLACMATNSSEVFNACIKAAKEHRSAAKN--CLGLHLEGPFLNPKRL 130 2778**********************************************..9*************** PP TIGR00221 141 GahpkeyirepdvellkkfldeagdvitkvtlapeekqtaelisklleagiivsaGhtnatyeelkea 208 Gah + ++r+++ + +k+++d +vi+++t+ap e q e+i+ ll++g++vs+Gh+nat++e+++a lcl|FitnessBrowser__Pedo557:CA265_RS18930 131 GAHVPAFVRKASLDEIKELIDFGDGVIKMMTIAP-EIQDDEVIQYLLDHGVVVSLGHSNATFDEATAA 197 *************999******************.88999**************************** PP TIGR00221 209 fkaGitfathlynamskldhRepgviGavLdeddvvteiiaDGlhihpknirlakklkgdsklvlvtD 276 +++Gi +thl+nams+++hRepg+ av +++ ++ iiaDG h++++ ++ a+kl + +l l+tD lcl|FitnessBrowser__Pedo557:CA265_RS18930 198 YNKGIQTTTHLFNAMSPIHHREPGIPTAVFNHNKAMASIIADGQHVDFEVLKFAQKLLKE-RLFLITD 264 ******************************************************999888.8****** PP TIGR00221 277 slaaagaklekfifaGkevyiredtlldkngtlaGssltmiegvknlvefveislsdvvrisslnpar 344 +++a + ++ ++ + +e++ + +gtl+Gss+tm+++vkn v ++ islsd v++ +l+pa+ lcl|FitnessBrowser__Pedo557:CA265_RS18930 265 AVTACS--TGPYQHV-----EKENKYVMPDGTLSGSSITMLQAVKNCVTHCAISLSDGVKMGTLYPAQ 325 **9854..4666554.....367888999*************************************** PP TIGR00221 345 algiddrlGsvakGkdanLavltkdfeviltiveg 379 +gi++ ++a+G++anL vl+ + ++ i +g lcl|FitnessBrowser__Pedo557:CA265_RS18930 326 LIGIENLTATIATGHQANLLVLDDELSLKEVIFRG 360 *****************************999987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (380 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 18.31 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory