GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deh in Pedobacter sp. GW460-11-11-14-LB5

Align The acetate/monochloroacetate (haloacid) permease, Deh4p (Km = 5.5 mμM for acetate; 9 mμM for monochloroacetate) (characterized)
to candidate CA265_RS19920 CA265_RS19920 MFS transporter

Query= TCDB::Q7X4L6
         (552 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS19920 CA265_RS19920 MFS
           transporter
          Length = 507

 Score =  466 bits (1198), Expect = e-135
 Identities = 253/538 (47%), Positives = 336/538 (62%), Gaps = 48/538 (8%)

Query: 19  RVIFASSLGTVFEWYDFYLAGSLAIYISRTFFSGVNPAAGFVFTLLGFAAGFAVRPFGAI 78
           +VI ASSLGT+ EWYDFY+ GSLA+ I    F     A+  + TL  FAAGF VRPFGA+
Sbjct: 12  KVIGASSLGTLIEWYDFYIFGSLAVIIGHQLFPEDAGASALINTLAIFAAGFIVRPFGAL 71

Query: 79  VFGRLGDMIGRKYTFLATILLMGLSTFVVGLLPGYGTIGMTAPVVFIAMRMLQGLALGGE 138
           VFGRLGD+IGRKYTFL T++LMG STF +GL+P Y +IG  AP++ + +R++QGLALGGE
Sbjct: 72  VFGRLGDLIGRKYTFLLTLVLMGGSTFFIGLIPSYKSIGYAAPILVLILRLIQGLALGGE 131

Query: 139 YGGAATYVAEHAPSNKRGAWTAWIQTTATLGLFISLLVILSVRSLLNEDTFAAWGWRVPF 198
           YGGAATYVAEHAP NKRG +T+WIQTTATLGLF+SL +I+  +++L  +TF  WGWR+PF
Sbjct: 132 YGGAATYVAEHAPKNKRGFFTSWIQTTATLGLFLSLGIIVITKNILGAETFGDWGWRIPF 191

Query: 199 LVSIVLLAVSVWIRMQLHESPVFERIKAEGKTSKAPLSEAFGQWKNLKIVLLALFGLTAG 258
           L+SIVL+ VS++IRM++HESP+F ++KAEG  SK PL E+F    N K+VLLALFG T G
Sbjct: 192 LLSIVLVVVSIYIRMKMHESPMFSKLKAEGNVSKNPLKESFNNKANFKMVLLALFGATMG 251

Query: 259 QAVVWYTGQFYTLFFLTQTLKVDGTSANMLVAVALLIGTPFFLFFGSLSDKIGRKPIIMA 318
           Q V+WYTGQFY   FL  T K+D   +  ++   +   TPFF+ FG+ SDK+GRK I+++
Sbjct: 252 QGVIWYTGQFYAQSFLENTCKLDFNDSRYILLWGIAFATPFFVIFGAWSDKVGRKWIMLS 311

Query: 319 GCLIAALTYFPLFKALAHYTNPKLEAATLQAPITMIADPSECSFQFNPVGTAKFTSSCD- 377
           G L+  L Y P+++     T+            T I      S +  PV +    +S D 
Sbjct: 312 GMLLGILFYRPIYQIFLDDTD-----------YTKIEQTDILSARPAPVTSVLIANSTDS 360

Query: 378 ---VAKGALSKAGLNYENI-TAPAGTVAQIRIGDKVVDAYDGKAADAKARGAEFEQTLSK 433
              V+   + K G ++  + T        I +G +VV                       
Sbjct: 361 LRTVSTKVMLKNGASFNKVQTDTVSATKGILLGKEVV----------------------- 397

Query: 434 SLETAGYPAKADPALINWPMSILILTILVLYVTMVYGPLAAMLVEMFPARIRYTSMSLPY 493
                    K  P  + W    LI    +L VTMVYGP+AA LVE+FP +IRYTSMSLPY
Sbjct: 398 -------KDKILPTPVFWKFVGLIF-FQILLVTMVYGPIAAFLVELFPTKIRYTSMSLPY 449

Query: 494 HIGNGWFGGFLPATAFAIIAARGNI-YSGLWYPIVIASVAFVIGTLFVKETKGSSTYD 550
           HIGNG FGG +P  A  I +  G+   SGLWYPI IA+++ VIG +++   +  +  D
Sbjct: 450 HIGNGVFGGLVPFIATLIASFSGSTPLSGLWYPIGIAALSLVIGAIYLSNKRDENIND 507


Lambda     K      H
   0.325    0.139    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 730
Number of extensions: 37
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 552
Length of database: 507
Length adjustment: 35
Effective length of query: 517
Effective length of database: 472
Effective search space:   244024
Effective search space used:   244024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory