GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deh in Pedobacter sp. GW460-11-11-14-LB5

Align Acetate/monochloroacetate permease, Deh4p, of 468 aas and 12 TMSs (characterized)
to candidate CA265_RS22390 CA265_RS22390 alpha-ketoglutarate transporter

Query= TCDB::M1Q159
         (468 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS22390 CA265_RS22390
           alpha-ketoglutarate transporter
          Length = 428

 Score =  206 bits (524), Expect = 1e-57
 Identities = 134/426 (31%), Positives = 218/426 (51%), Gaps = 27/426 (6%)

Query: 15  KVIFASSAGTVIEWYDFYIFGALATTLASKFYNTGTPIGDIIAWLGTFAVGFLVRPFGAI 74
           K IF  S G ++EWYD+Y + A A   +  F+    P   ++   G FAVGFL+RP G  
Sbjct: 14  KSIFGGSVGNLVEWYDWYTYSAFALYFSPAFFPNSNPTAQLLDTAGIFAVGFLMRPIGGW 73

Query: 75  VFGRIGDLVGRKFTYLITITIMGSCTFLIGLLPTQDVLGAWAGIILITMRILQGLALGGQ 134
           +FG I D +GRK +  +++ IM   + +IGL P    +G  A ++LI  R++QGL+ GG+
Sbjct: 74  LFGSIADKLGRKRSMTLSVLIMAIGSLIIGLTPGYKQIGIAAPLLLIFARLIQGLSTGGE 133

Query: 135 YGGAATFVAEHAPQGKRGFYTSWIQTTATFGLLISLGV-ILITRISLGEADFNEWGWRLP 193
           YG +AT+++E A +  RGFY+S+   T   G L++LG+ +++    L  A+ +EWGWR+P
Sbjct: 134 YGTSATYLSEMATKKHRGFYSSFQYVTLIGGQLLALGIQLILQNWLLTPAELHEWGWRIP 193

Query: 194 FMASILLVILSLWIRRALKESPLFQQLKDTKAVSKNPLKESFANPYNLRWVLIALFGATM 253
           F    +L  ++L++RR + E+  F+  K+T A  K  +      P      +  + G T+
Sbjct: 194 FFIGAILSFIALYLRRHIDETSAFKS-KNT-ADKKGGIAVLMKYPKE----VFTVVGLTL 247

Query: 254 GQGVVWYTGQFYALFYLQKIFNTPLIDSNLIVGAALLLSMPFFVFFGSLSDRIGRKKVML 313
           G  + +YT   Y   +L    +     S  +   +LL+ +     FG LSD+IGRK +++
Sbjct: 248 GGTIAFYTFSTYMQKFLVNTVHLSKETSTTLSFISLLVFVVLQPLFGLLSDKIGRKPLLI 307

Query: 314 SGMLLAVLTYYPIYGLMAAFAPTDPGQHFLFAYIGYNPVILGLLVFIQVIYVTMVYGPIA 373
              +L  L  YPI   +A  +               N  I+ LL+   +I V+      A
Sbjct: 308 GFGVLGTLCTYPILTGLAGES---------------NTTIIFLLMIGALIIVSGYTSINA 352

Query: 374 AFLVELFPTKIRYTSMSLPYHIGNGVFGGLVPMIGLILINATGNDFAGLWWPMAIAGICL 433
               ELFP +IR   + LPY +   +FGG      L   N  G++    W+   + G C+
Sbjct: 353 VVKAELFPAEIRALGVGLPYALTVAIFGGTAEYFALWFKN-IGHENYFYWY---VTG-CI 407

Query: 434 VVGFLL 439
           ++  +L
Sbjct: 408 LISLIL 413



 Score = 42.4 bits (98), Expect = 3e-08
 Identities = 51/183 (27%), Positives = 84/183 (45%), Gaps = 26/183 (14%)

Query: 240 NLRWVLIALFGATMGQGVV---WYTGQFYALFYLQKIF-----NTPLIDSNLIVGAALLL 291
           ++ + L ++FG ++G  V    WYT   +AL++    F        L+D+  I     L+
Sbjct: 8   DVEYRLKSIFGGSVGNLVEWYDWYTYSAFALYFSPAFFPNSNPTAQLLDTAGIFAVGFLM 67

Query: 292 SMPFFVFFGSLSDRIGRKKVM-LSGMLLAVLTYYPIYGLMAAFAPTDPGQHFLFAYIGY- 349
                  FGS++D++GRK+ M LS +++A+ +   I GL        PG    +  IG  
Sbjct: 68  RPIGGWLFGSIADKLGRKRSMTLSVLIMAIGSL--IIGL-------TPG----YKQIGIA 114

Query: 350 NPVILGLLVFIQVIYVTMVYGPIAAFLVELFPTKIRYTSMSLPYHIGNGVFGGLVPMIGL 409
            P++L     IQ +     YG  A +L E+   K R    S  Y     + GG +  +G+
Sbjct: 115 APLLLIFARLIQGLSTGGEYGTSATYLSEMATKKHRGFYSSFQYVT---LIGGQLLALGI 171

Query: 410 ILI 412
            LI
Sbjct: 172 QLI 174


Lambda     K      H
   0.328    0.144    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 616
Number of extensions: 43
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 468
Length of database: 428
Length adjustment: 33
Effective length of query: 435
Effective length of database: 395
Effective search space:   171825
Effective search space used:   171825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory