GapMind for catabolism of small carbon sources

 

Aligments for a candidate for BT0355 in Pedobacter sp. GW460-11-11-14-LB5

Align Na+/glucose cotransporter (characterized, see rationale)
to candidate CA265_RS06755 CA265_RS06755 sodium transporter

Query= uniprot:Q8AAV7
         (564 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS06755 CA265_RS06755 sodium
           transporter
          Length = 542

 Score =  272 bits (696), Expect = 2e-77
 Identities = 194/583 (33%), Positives = 306/583 (52%), Gaps = 63/583 (10%)

Query: 1   MEALDWLVIGVFFLALIGIIVWVVR---QKQNDSADYFLGGRDATWLAIGASIFASNIGS 57
           + A D+ V  ++F+ +     WV R   +K+ D+ DYFL     TW AIGASI ASNI +
Sbjct: 4   LSAFDYAVFLMYFVIVSAYGYWVYRSKKKKRTDTKDYFLAEGSLTWWAIGASIIASNISA 63

Query: 58  EHLIGLAGAGASSGMAMAHWEIQGWM----ILILGWVFVPFYSRSMVYTMPEFLERRYNP 113
           EH IG++G+G + G+A+A +E   WM    ++I+   F+P Y ++ +YTMP+FL  RYN 
Sbjct: 64  EHFIGMSGSGFAMGLAIASYE---WMAAATLIIVAIFFLPIYIKNKIYTMPQFLSNRYNN 120

Query: 114 QSRTILSVISLVSYVLTKVAVTVYAGGLVFQQVFGIKELWGIDFFWIAAIGLVVLTALYT 173
              T+++V  L+ YV   +    + G +  + + G+        F I  I L + +A+ T
Sbjct: 121 TVSTLMAVFWLLVYVFVNLTSIFFLGAIAIETITGVP-------FNICIIFLAIFSAIIT 173

Query: 174 IFGGMKSVLYTSVLQTPILLLGSLIILVLGFKELGGWDEMMRVCGAVTV--NDYGDTMTN 231
           + GGMK + YT V+Q  +L+ G LI   +  K +    +   V  ++ +  ++  D    
Sbjct: 174 L-GGMKVIGYTDVIQVFVLVAGGLITCYMALKLVSEKLDAPSVLASLPLLRSEASDHFHM 232

Query: 232 LIRSNDD--ANFPWLGALIGSAIIGFW-----YWCTDQFIVQRVLSGKNEKEARRGTIFG 284
           +    D      P +  L+G    G W     YW  +Q+IVQR L G + K  R G IF 
Sbjct: 233 IFSKGDKFYNELPGIAVLVG----GLWINNLNYWGCNQYIVQRAL-GADLKTGRNGLIFA 287

Query: 285 AYLKLLPVFLFLIPGMIAFALHQKYIGAGGEGFLPML-ANGTANADAAFPTLVAKLLPAG 343
           A+LKLL   + +IPG+ A+ L+Q+     G     ML A G    D A+P L+  LLPAG
Sbjct: 288 AFLKLLIPVIVVIPGIAAYVLYQR-----GYFHSEMLDAAGVVKPDHAYPVLM-NLLPAG 341

Query: 344 VKGLVVCGILAALMSSLASLFNSSAMLFTIDFYKRF-RPETPEKKLVGIGQIATVVIVIL 402
           +KGL    + AA+++SLA   NS A +FT+D YK+F +PE  E +LV +G+ + V+  ++
Sbjct: 342 IKGLAFAALTAAIVASLAGKCNSIATIFTLDIYKKFIKPEASETRLVSVGRWSVVIASLI 401

Query: 403 GILWIPIMRSVGDVLYTYLQDVQSVLAPGIAAAFLLGICWKRTSAQGGMWGLIAGMIIGL 462
            I+  P +RS  D +Y ++Q+    ++PG+ A FLLG  WK+T+++  +   +  + I L
Sbjct: 402 AIIIAPALRSF-DQVYQFIQEYVGFISPGVFAIFLLGFFWKKTTSRAALTAAL--LTIPL 458

Query: 463 TRLGAKVYYSNAGEVADSTFKYLFYDMNWLFFCGWMFLFCIIVVIVVSLATEAPTAEKIQ 522
           + L   +     G +A   F         L    W+F+  I ++IVV+L T+  + +  Q
Sbjct: 459 STLFKFLPAVTNGAIAPIPF---------LNRMSWVFMIIIGLMIVVTL-TDPKSKDNPQ 508

Query: 523 GL-VFGTATKEQKAATRASWDHWDIIHTVIILAITGAFYWYFW 564
           GL +  +  K   A T AS         V+I  I  A Y  FW
Sbjct: 509 GLEIDSSMFKVTPAFTIAS---------VMICGILAALYTVFW 542


Lambda     K      H
   0.328    0.142    0.454 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 855
Number of extensions: 45
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 564
Length of database: 542
Length adjustment: 36
Effective length of query: 528
Effective length of database: 506
Effective search space:   267168
Effective search space used:   267168
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory