GapMind for catabolism of small carbon sources

 

Aligments for a candidate for Echvi_1880 in Pedobacter sp. GW460-11-11-14-LB5

Align SSS sodium solute transporter (characterized, see rationale)
to candidate CA265_RS06755 CA265_RS06755 sodium transporter

Query= uniprot:L0FZT5
         (624 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS06755 CA265_RS06755 sodium
           transporter
          Length = 542

 Score =  489 bits (1260), Expect = e-142
 Identities = 266/555 (47%), Positives = 364/555 (65%), Gaps = 38/555 (6%)

Query: 6   STLDYVIFIVYALAIVSVGLWVSRTKKGLEKTAQEYFLADKSLTWWAVGASLLAANISAE 65
           S  DY +F++Y + + + G WV R+KK      ++YFLA+ SLTWWA+GAS++A+NISAE
Sbjct: 5   SAFDYAVFLMYFVIVSAYGYWVYRSKKKKRTDTKDYFLAEGSLTWWAIGASIIASNISAE 64

Query: 66  HFIGTSGSGFAIGLGISAYEWIAAIALIIVAKYFLPIFLKHGVYTMPQFLSERFNKGVST 125
           HFIG SGSGFA+GL I++YEW+AA  LIIVA +FLPI++K+ +YTMPQFLS R+N  VST
Sbjct: 65  HFIGMSGSGFAMGLAIASYEWMAAATLIIVAIFFLPIYIKNKIYTMPQFLSNRYNNTVST 124

Query: 126 AFAVFWLLVYVFVNLTSVSYLGALALDKIMGIPLQYGIIGLLIFSGIYSIYGGLEAVAWT 185
             AVFWLLVYVFVNLTS+ +LGA+A++ I G+P    II L IFS I ++ GG++ + +T
Sbjct: 125 LMAVFWLLVYVFVNLTSIFFLGAIAIETITGVPFNICIIFLAIFSAIITL-GGMKVIGYT 183

Query: 186 DVVQVIILVAGGLITTFLALDAVGM---GDGIFAGMSNLYNDAKDHFVMIMPQGRVMVPD 242
           DV+QV +LVAGGLIT ++AL  V        + A +  L ++A DHF MI  +G      
Sbjct: 184 DVIQVFVLVAGGLITCYMALKLVSEKLDAPSVLASLPLLRSEASDHFHMIFSKGDKF--- 240

Query: 243 GLGGSRDAFQDLPGLAVILGGMWLTNLGYWGFNQYIIQKGLAAKSIEEAKKGLLFAGYLK 302
                   + +LPG+AV++GG+W+ NL YWG NQYI+Q+ L A  ++  + GL+FA +LK
Sbjct: 241 --------YNELPGIAVLVGGLWINNLNYWGCNQYIVQRALGA-DLKTGRNGLIFAAFLK 291

Query: 303 LLMPIIVVIPGIAAYVLIND--YSPEQLAAILNMPVEHIGTIQKSDEAYPWLLRNFIPNG 360
           LL+P+IVVIPGIAAYVL     +  E L A           + K D AYP +L N +P G
Sbjct: 292 LLIPVIVVIPGIAAYVLYQRGYFHSEMLDA---------AGVVKPDHAYP-VLMNLLPAG 341

Query: 361 IRGLAFAALAAAIVSSLASMINSTSTIFTMDIYKVYFKPNANNHQLVRTGRIVAVVALAI 420
           I+GLAFAAL AAIV+SLA   NS +TIFT+DIYK + KP A+  +LV  GR   V+A  I
Sbjct: 342 IKGLAFAALTAAIVASLAGKCNSIATIFTLDIYKKFIKPEASETRLVSVGRWSVVIASLI 401

Query: 421 AMIVAPQLASLDQVFQYIQEYTGYIYPGVVVVFGMGLIWRQATASAALWTAIATIPAGIV 480
           A+I+AP L S DQV+Q+IQEY G+I PGV  +F +G  W++ T+ AAL  A+ TIP   +
Sbjct: 402 AIIIAPALRSFDQVYQFIQEYVGFISPGVFAIFLLGFFWKKTTSRAALTAALLTIPLSTL 461

Query: 481 FKIFYP--------EMPFLLRMGYVFIILCFIASLISFAEKKKFANPDYKTNKQAAKTVA 532
           FK F P         +PFL RM +VF+I+  +  +++  + K   NP       +   V 
Sbjct: 462 FK-FLPAVTNGAIAPIPFLNRMSWVFMIIIGLMIVVTLTDPKSKDNPQGLEIDSSMFKVT 520

Query: 533 SSYFFIILGIICAVL 547
            + F I   +IC +L
Sbjct: 521 PA-FTIASVMICGIL 534


Lambda     K      H
   0.327    0.142    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1081
Number of extensions: 46
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 624
Length of database: 542
Length adjustment: 36
Effective length of query: 588
Effective length of database: 506
Effective search space:   297528
Effective search space used:   297528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory