Align D-xylonate dehydratase subunit (EC 4.2.1.25; EC 4.2.1.82) (characterized)
to candidate CA265_RS13665 CA265_RS13665 galactonate dehydratase
Query= metacyc::MONOMER-18070 (393 letters) >FitnessBrowser__Pedo557:CA265_RS13665 Length = 388 Score = 171 bits (433), Expect = 3e-47 Identities = 116/380 (30%), Positives = 194/380 (51%), Gaps = 22/380 (5%) Query: 3 KISEIEAYILGKEVTSAQWASLMVLVRVTTNDGRVGWGETVSALRAEAVANFVKKINTVL 62 KI++++ +++ E W L+++ T+ G G GE + + V K + + Sbjct: 2 KITDVKVWLV--EGVKYNWT----LLKIYTDTGHTGVGEATNWPGSPIVFEATKHVGQRI 55 Query: 63 KGNDVFNVEKNRLEWYKHDFNMTISLESTTAYSAVDIASWDIIGKELGAPLYKLLGGKTR 122 G D + + Y+ M S A S +D+A D+ K LG P Y+LLGG R Sbjct: 56 IGLDPMKTDFIWTKLYRDLNWMGPFGASMCAISGIDMALLDLKAKVLGVPCYELLGGAFR 115 Query: 123 DKVLVYANGWYQNCV-KPEDFAEKAKEIVKMGYKALKFDPFGP----YFNDISKK----- 172 +L+YAN W+ D+A +AK++ + G+ LKFDPF Y D+S Sbjct: 116 KDILLYANYWFTGGGHNTADYAAQAKKVKEAGFTGLKFDPFAHTNYLYGEDLSSNLQLTA 175 Query: 173 -GLDIAEERVKAVREAVGDNVDILIEHHGRFNANSAIMIAKRLEKYNPLFMEEPIHPEDV 231 D+A KAVR+AVG DI+IE H N A+ +A+RL + N + EEP PE+ Sbjct: 176 PQQDLAFNVSKAVRDAVGPEFDIMIETHAMLNYRVAVTMAQRLSELNITWYEEPAGPENA 235 Query: 232 EGLRKYRNN--TSLRIALGERIINKQQALYFMKEGLVDFLQADLYRIGGVTETKKVVGIA 289 L+ R+ +++ I +GER + +++ + D + D+ R GG +E K++ + Sbjct: 236 NTLKAMRDRIPSNVSICVGERHYTRHGIRDVLEKHICDIMMPDITRCGGPSEMKRMATMM 295 Query: 290 ETFDVQMAFHNAQGPILNAVTLQFDAFIPNFLIQESFYDWFPSWKRELIYN--GTPIDNG 347 E ++V +A HN GP+ + Q A +PNF QE ++ P W+ E+I + + NG Sbjct: 296 EAYNVLLAPHNPNGPLSTLASAQVCASVPNFFRQEFMFNDVP-WRDEVISHPIADMVQNG 354 Query: 348 YAIIPERPGLGVEVNEKMLD 367 + + +RPGLGV++ E+ ++ Sbjct: 355 HLKLSDRPGLGVDLIEEEME 374 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 388 Length adjustment: 31 Effective length of query: 362 Effective length of database: 357 Effective search space: 129234 Effective search space used: 129234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory