Align Putative agmatine deiminase; EC 3.5.3.12; Agmatine iminohydrolase (uncharacterized)
to candidate CA265_RS15455 CA265_RS15455 agmatine deiminase
Query= curated2:C1C6Q3 (361 letters) >FitnessBrowser__Pedo557:CA265_RS15455 Length = 358 Score = 246 bits (627), Expect = 9e-70 Identities = 141/365 (38%), Positives = 203/365 (55%), Gaps = 34/365 (9%) Query: 4 SPKKLGYHMPAEYEPHHGTLMIWPTRPGSWPFQGKAAKRAFTQIIETIAEGERVYLLVEQ 63 SPK+ GY PAE+ H T + WP + SWP + + + Q I+ +AEGE+V + V+ Sbjct: 18 SPKQQGYAFPAEWAKHEATWLSWPHKEASWPDKIETIYEPYCQFIKAVAEGEKVRINVKD 77 Query: 64 --------AYLSEAQSYLGDKVVYLDIPTNDAWARDTGPTILVNDKGKKLAVDWAFNAWG 115 + L++ + L Y + TNDAW RD GP L+ +K VDW +NAWG Sbjct: 78 EEMKAFAVSELTKVDADLSQIEFYFN-ETNDAWCRDHGPAFLLKGN-EKAVVDWGYNAWG 135 Query: 116 GTYDGLYQDYEEDDQVASRFAEALERPVYDAKPFVLEGGAIHSDGQGTILVTESCLLSPG 175 G Y ++ DD V ++ A + P++ V+EGG++ +G GT+L T +CLL+ Sbjct: 136 GKYP----PFDLDDVVPTKIANHFKLPLF-TPDIVMEGGSVEFNGAGTVLTTTACLLNEN 190 Query: 176 RNPNLTKEEIENTLLESLGAEKVIWLPYGIYQDETNEHVDNVAAFVGPAELVLAWTDDEN 235 RNP+LTK +IE LLE G E+V+WL GI D+T+ H+D++ FV ++ + Sbjct: 191 RNPHLTKAQIEQYLLEYYGQEQVLWLGDGIVGDDTDGHIDDITRFVNEDTVLTVVESNPL 250 Query: 236 DPQYAMSKADLELLEQETDAKGCHFTIHKLPIPAVRQVVTEEDLPGYIYEEGEEKRYAGE 295 D Y + + +L L+ G I +LP+P+ V ED Sbjct: 251 DENYLLLQENLAALKAMKLKDGRALNIVELPMPSP---VIHEDT---------------- 291 Query: 296 RLAASYVNFYIANKAVLVPQFEDVNDQVALDILSKCFPDRKVVGIPARDILLGGGNIHCI 355 RL ASY NFYIAN AV+VP F+DVNDQ AL I+ CFPDRKV+GI + DI+ G G+ HC+ Sbjct: 292 RLPASYANFYIANAAVIVPVFDDVNDQKALAIIQGCFPDRKVIGINSVDIIWGLGSFHCL 351 Query: 356 TQQIP 360 +QQ P Sbjct: 352 SQQEP 356 Lambda K H 0.316 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 358 Length adjustment: 29 Effective length of query: 332 Effective length of database: 329 Effective search space: 109228 Effective search space used: 109228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory