Align N-carbamoylputrescine amidohydrolase (EC 3.5.1.53) (characterized)
to candidate CA265_RS15465 CA265_RS15465 acyltransferase
Query= metacyc::MONOMER-17350 (290 letters) >FitnessBrowser__Pedo557:CA265_RS15465 Length = 291 Score = 298 bits (762), Expect = 1e-85 Identities = 143/291 (49%), Positives = 191/291 (65%), Gaps = 6/291 (2%) Query: 1 MKIALIQQKFHSNKEQTIKKTCEFIEEASKQGAELICLGELHQSEYFCQSENVDFFDYAN 60 +K+ L+Q K++ + K + EA+ +GA+++CL EL S YFC E+ D FD A Sbjct: 4 VKVGLVQMSCTKVKQENLDKAIAKVREAAAKGAQIVCLQELFTSLYFCDVEDYDNFDLAE 63 Query: 61 DYE-KDVKFWANIARKNQIVLITSLFEKRSAGLYHNTAVVFEKDGSIAGKYRKMHIPDDP 119 +A++ +V+I SLFEKR+ GLYHNT V + DGS GKYRKMHIPDDP Sbjct: 64 AIPGPSTDALQVVAKELGVVIIASLFEKRAEGLYHNTTAVLDADGSYLGKYRKMHIPDDP 123 Query: 120 CFYEKFYFTPGDLGFEPINTSLGKLGVLICWDQWYPEAARIMALKGAEILIYPTAIGWFD 179 FYEKFYFTPGDLG++ T K+G+LICWDQWYPEA+RI AL GA+I+ YPTAIGW Sbjct: 124 AFYEKFYFTPGDLGYKVFETKFAKIGILICWDQWYPEASRITALMGADIMFYPTAIGWAT 183 Query: 180 KDKDEEKQRQLNAWLGVQKGHAIANGLYVVAINRVGFEKDVSGVEEGIRFWGNSFVFGPQ 239 +E Q Q NAW +Q+ HA+ANG+ VV++NRVGFE+D ++FWG SF Q Sbjct: 184 DQDEETNQDQYNAWQTIQRSHAVANGVPVVSVNRVGFEQD-----GAMKFWGGSFATNGQ 238 Query: 240 GEELCLLDSQNECVKIIEIDKKRSENVRRWWPFLRDRRIEYFADLTKRFID 290 G+ L L E +++E+D S+ R+ WPFLRDRRI+ + +TKR+ID Sbjct: 239 GKLLYLASHDLEETEVVELDLSESDFFRKHWPFLRDRRIDSYQPITKRYID 289 Lambda K H 0.322 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 291 Length adjustment: 26 Effective length of query: 264 Effective length of database: 265 Effective search space: 69960 Effective search space used: 69960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory