Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate CA265_RS16020 CA265_RS16020 ABC transporter ATP-binding protein
Query= SwissProt::P54537 (240 letters) >FitnessBrowser__Pedo557:CA265_RS16020 Length = 250 Score = 146 bits (369), Expect = 3e-40 Identities = 88/228 (38%), Positives = 138/228 (60%), Gaps = 10/228 (4%) Query: 1 MIKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGTITI 60 MI+++ + KSF ++VL+ IS EG +IG SGSGK+T L+C+ L +P+ G++ Sbjct: 1 MIEIKDIYKSFSGNDVLQGISGKFEEGVTNLIIGGSGSGKTTLLKCMVGLHQPDSGSVLY 60 Query: 61 KDTEITKPKT--NTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNV-KKESKQAAQEKA 117 + T P T ++VR+ IGM+FQ LF TV ENIM+ P+N+ +S++ E+ Sbjct: 61 DGRDFT-PMTYEQRIEVRKEIGMLFQGSALFDSMTVEENIMF-PLNMFTDQSRKEKLERV 118 Query: 118 EDLLRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPE---MVKE 174 + L +V L K +P LSGG K+RV IARA++MNP + DEP S LDP+ ++ E Sbjct: 119 DFCLERVNLAGKNKLFPAELSGGMKKRVGIARAISMNPKYLFCDEPNSGLDPKTSIVIDE 178 Query: 175 VLQVMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKE 222 ++Q + E +T T ++VTH+M + D +LF+ +G +G+ KE Sbjct: 179 LIQEITEEYKT--TTIVVTHDMNSVMGIGDYILFLHEGKKFWEGSNKE 224 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 250 Length adjustment: 24 Effective length of query: 216 Effective length of database: 226 Effective search space: 48816 Effective search space used: 48816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory