Align Succinylglutamic semialdehyde dehydrogenase (EC 1.2.1.71) (characterized)
to candidate CA265_RS24850 CA265_RS24850 aldehyde dehydrogenase
Query= reanno::SB2B:6938906 (486 letters) >FitnessBrowser__Pedo557:CA265_RS24850 Length = 454 Score = 177 bits (450), Expect = 5e-49 Identities = 136/444 (30%), Positives = 221/444 (49%), Gaps = 13/444 (2%) Query: 17 MQSKNPANGEVIWQGKAAVPAQVQAAVMAARDAQFEWFMLGFEGRQAIVEAYRNELEANK 76 MQ NPA E+I + + +Q A + AQ +W + R A++ + + LE Sbjct: 1 MQIINPATAEIITSLEEDNLSTLQLKFDALQKAQPQWAGKTLQERIAVITHFSDLLEVEI 60 Query: 77 AELAEVIAQETGKPRWETATEAAAMIGKIGLSVSAYHKRTGTEVNEGAAG-RAVLRHKPH 135 +LA V+ E GKP ++ E +I ++ K EV G + +++++P Sbjct: 61 EKLASVLTSEVGKPLQQSRNEINGARARIKWMLANAEKYLADEVMTDEPGIKEIIKYEPL 120 Query: 136 GVVAVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSELTPKVAELMLKLWEKAGLPAGVIN 195 GVV +N+P + +PALL+GNTV++KPSE + KL +KAG+P V + Sbjct: 121 GVVCNISAWNYPYLVGVNVFIPALLSGNTVMYKPSEYATLTGIEIEKLLKKAGVPDDVFH 180 Query: 196 LVQGEVETGKALASHPQLDGLFFTGSSRTGHLLHQQYAGHPGKILALEMGGNNPL-IVKG 254 + G ETG AL + +G FFTGS +TG L++++ A LE+GG +PL I Sbjct: 181 IAIGAKETGSALL-NMDFNGYFFTGSYKTGKLIYEKVAAKMVP-CQLELGGKDPLYITDD 238 Query: 255 VSDTRAAIHDIIQSAFISSGQRCTCARRLYVEKGAEGDKLLAGLVEAVKAIKVGPWNADP 314 V+D AA AF ++GQ C R+YV++ D A + E VK+ K G A+ Sbjct: 239 VTDVAAAAIGTADGAFYNNGQSCCAVERIYVQEKNYDDYCNAFVTE-VKSWKTGIPTAE- 296 Query: 315 QPFMGSMISETAAKGMLDAQRNLLNLGAKSLVEMTHLQAGTGLVSPG-LIDVTEVIELPD 373 ++G++ + + + ++ LN GAK L ++ P L DVT + + Sbjct: 297 GVYIGALTRKEQISVLENQVKDALNKGAKLLTGGKAVEGKGYYFEPTVLTDVTNDMLVMQ 356 Query: 374 EEYFGPLLQVVRYTSFDEAIRLANDTRYGLSAGILADDKADYEYFLARIRAGIVNWNKQI 433 EE FGP++ +++ EA+++ DT YGL+A + + E LA++ AG WN Sbjct: 357 EESFGPIIGIMKVKDDAEALKMMKDTDYGLTASVYTASQERAEKILAQLDAGSGYWN-CC 415 Query: 434 TGASGAAP-----FGGVGASGNHR 452 S A P + G+GA+ +H+ Sbjct: 416 DRVSAALPWSGRKYSGIGATLSHQ 439 Lambda K H 0.317 0.133 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 486 Length of database: 454 Length adjustment: 33 Effective length of query: 453 Effective length of database: 421 Effective search space: 190713 Effective search space used: 190713 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory