Align gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate CA265_RS21385 CA265_RS21385 aldehyde dehydrogenase family protein
Query= reanno::WCS417:GFF5420 (497 letters) >FitnessBrowser__Pedo557:CA265_RS21385 Length = 465 Score = 139 bits (349), Expect = 3e-37 Identities = 105/339 (30%), Positives = 155/339 (45%), Gaps = 10/339 (2%) Query: 156 EPVGVVGAIVPWNFPLMMACWKLGPALSTGNSVILKPSEKSPLTAIRIAALAVEAGIPKG 215 EP GV I PWN+PL + L A++ GN VILKPSE S TA I+ L + Sbjct: 104 EPKGVCLIIAPWNYPLQLIMSPLVSAIAAGNCVILKPSELSAATADVISKLISNTFEAE- 162 Query: 216 VFNVLPGYGHTVGNALALHMDVDTLVFTGSTKIAKQLLIRSGESNMKRVWLEAGGKSPNI 275 + G + L + D + FTGST I K +++ + N+ V LE GGKSP I Sbjct: 163 --EIACFEGDAEVSTALLKLPFDHIFFTGSTAIGK-VVMEAAAKNLTSVTLELGGKSPAI 219 Query: 276 VFADAPDLQAAAESAAGAIAFNQGEVCTAGSRLLVERSIKDKFLPLVIEALKGWKPGNPL 335 V + DL+ AAE A N G+ C A +L++ +I F A++ Sbjct: 220 V-DETCDLKKAAEKIAWGKLVNAGQTCIAPDYVLIKENISADFEMYYQAAVQKMFFNEAA 278 Query: 336 DPATNVGALVDTQQMNTVLSYIEAGHADGAKLVAGGKRTLEETGGTYVEPTIFDGVTNAM 395 + +++ +Q + IE DGA L GGK + + PT+ V + Sbjct: 279 INKNDYAKIINIKQFQRLNKLIEEAIRDGAVLAFGGK---SDEQNLTITPTLLTSVAESS 335 Query: 396 KIAKEEIFGPVLSVITFDSAEEAVAIANDTIYGLAAAVWTADISKAHLTAKALRAGSVWV 455 I +EEIFGPVL VIT+ + +EA+ + N LA +++ + + AG V Sbjct: 336 AIMQEEIFGPVLPVITYQNLQEAIDVVNRKAKPLALYIFSDSTTNQNKIISETSAGGTCV 395 Query: 456 NQ--YDGGDMTAPFGGFKQSGNGRDKSLHAFDKYTELKA 492 N G+ PFGG SG G + F ++ +A Sbjct: 396 NDVLVHIGNPDLPFGGVNNSGIGSCHGIFGFKTFSHERA 434 Lambda K H 0.316 0.132 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 465 Length adjustment: 34 Effective length of query: 463 Effective length of database: 431 Effective search space: 199553 Effective search space used: 199553 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory