Align PP1068, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate CA265_RS10520 CA265_RS10520 ABC transporter ATP-binding protein
Query= TCDB::Q88NY5 (256 letters) >lcl|FitnessBrowser__Pedo557:CA265_RS10520 CA265_RS10520 ABC transporter ATP-binding protein Length = 568 Score = 128 bits (321), Expect = 3e-34 Identities = 92/261 (35%), Positives = 148/261 (56%), Gaps = 19/261 (7%) Query: 13 MISIKNVNKWY----GDFQVLTD-------CSTEVKKGEVVVVCGPSGSGKSTLIKCVNA 61 ++ IKN+ WY G F TD + EV GE + + G SG GK+TL + + Sbjct: 309 LLQIKNLCTWYPIHNGLFGKTTDYVKAVDQLNFEVFPGETLGLVGESGCGKTTLGRTILR 368 Query: 62 LEPFQKGDIVVDGTSIAD-PKTNLPKLRSRVGMVFQ--HFELFPHLTITEN-LTIAQRKV 117 L G+I+ +G +I KT L KLR + ++FQ + L P L+I ++ L Q Sbjct: 369 LIQPTSGEIIFNGENITHIGKTALRKLRKDIQIIFQDPYASLNPKLSIGQSILEPLQVHK 428 Query: 118 LGRSEAEATKKGLALLDRVGLSA-HAKKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPT 176 L R+++E +K L LLD+VGL H ++P + SGGQ+QRV IARALA+ P ++ DE Sbjct: 429 LYRNDSERKQKVLELLDKVGLKEEHFNRYPHEFSGGQRQRVVIARALALQPKFIICDESV 488 Query: 177 SALDPEMVSEVLDVMVQLAQE-GMTMMCVTHEMGFARKVANRVIFMDKGSIIEDCTKEEF 235 SALD + ++VL+++ L E G+T + ++H++ + +++R++ M+KG I E+ E+ Sbjct: 489 SALDVSVQAQVLNLIKDLQSEFGLTYIFISHDLAVVKHISDRILVMNKGKIEEEGFPEQI 548 Query: 236 FGDQSARDQRTQHLLSKILQH 256 F + + TQ L+ I H Sbjct: 549 F--YAPKAAYTQKLIEAIPGH 567 Score = 106 bits (265), Expect = 9e-28 Identities = 74/223 (33%), Positives = 124/223 (55%), Gaps = 12/223 (5%) Query: 26 FQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKCVNALEPFQK----GDIVVDGTSIADPK 81 F+ + S +VKKG V+ + G SGSGKS + L + G+I + S+ + Sbjct: 20 FKAVKQISFKVKKGTVLGIVGESGSGKSVTSFSIMRLHDERAAKITGEIDFEDISLLNLS 79 Query: 82 TN-LPKLR-SRVGMVFQHFELFPHLTITENLTIAQRKVLGRS--EAEATKKGLALLDRVG 137 +N + ++R +++ M+FQ + T +A+ +L R +AEA K +AL + V Sbjct: 80 SNEIRQIRGNQISMIFQEPMTSLNPVFTCGYQVAEAIMLHRKVDQAEAKKHTIALFNEVQ 139 Query: 138 LSAHAK---KHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVSEVLDVMVQL 194 L K +P Q+SGGQ+QRV IA AL+ DP +++ DEPT+ALD + +L ++++L Sbjct: 140 LPRPEKIFESYPHQISGGQKQRVMIAMALSCDPKLLIADEPTTALDVTVQKTILQLLLKL 199 Query: 195 AQE-GMTMMCVTHEMGFARKVANRVIFMDKGSIIEDCTKEEFF 236 QE M M+ ++H++G ++A+ V M KG I+E + F Sbjct: 200 KQERNMAMIFISHDLGVVNEIADEVAVMYKGEIVEQGPAKSIF 242 Lambda K H 0.319 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 22 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 256 Length of database: 568 Length adjustment: 30 Effective length of query: 226 Effective length of database: 538 Effective search space: 121588 Effective search space used: 121588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory