Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized)
to candidate CA265_RS07485 CA265_RS07485 macrolide ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_16275 (244 letters) >FitnessBrowser__Pedo557:CA265_RS07485 Length = 252 Score = 134 bits (338), Expect = 1e-36 Identities = 81/223 (36%), Positives = 129/223 (57%), Gaps = 8/223 (3%) Query: 1 MISIKNVNKWY----GDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKG 56 +I+IK + + Y L S ++ KGE + + GPSGSGKSTL+ + L+ G Sbjct: 5 LITIKEIGRKYVIGSEVIHALKSVSLDINKGEFVALMGPSGSGKSTLMNILGCLDTPSSG 64 Query: 57 DVVVDGTSIADPKTD-LPKLRSR-VGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEAT 114 V++GT+++ D L ++R++ +G VFQ F L P T +N+ + I G SK++ Sbjct: 65 TYVLNGTNVSHMSDDALAEVRNQEIGFVFQTFNLLPRSTSLDNVALPLIYA-GTSKKDRD 123 Query: 115 KKGLQLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNE 174 + + LE VGL P +LSGGQ+QRVA+ARAL +P ++L DEPT LD + E Sbjct: 124 ARAARALENVGLGNRMDHKPNELSGGQRQRVAVARALINNPSIILADEPTGNLDTKTSIE 183 Query: 175 VLDVMVQLANEGMTMMCVTHEMGFARKVADRVIFMDQGKIIED 217 ++ ++ ++ ++G T++ VTHE A+ A R++ M G I D Sbjct: 184 IMGLLEEIHSKGNTIILVTHEEDIAQH-AHRIVRMRDGLIEND 225 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 252 Length adjustment: 24 Effective length of query: 220 Effective length of database: 228 Effective search space: 50160 Effective search space used: 50160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory