Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate CA265_RS07485 CA265_RS07485 macrolide ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >FitnessBrowser__Pedo557:CA265_RS07485 Length = 252 Score = 138 bits (348), Expect = 9e-38 Identities = 86/229 (37%), Positives = 135/229 (58%), Gaps = 10/229 (4%) Query: 1 MIELKNVNKYY--GTH--HVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSG 56 +I +K + + Y G+ H LK+++L + +GE + ++GPSGSGKST + + L+ SSG Sbjct: 5 LITIKEIGRKYVIGSEVIHALKSVSLDINKGEFVALMGPSGSGKSTLMNILGCLDTPSSG 64 Query: 57 EVVVNNLVLNHKNK---IEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAE 113 V+N ++H + E+ + VFQ FNL P T L N+ L P+ SKK+ + Sbjct: 65 TYVLNGTNVSHMSDDALAEVRNQEIGFVFQTFNLLPRSTSLDNVAL-PLIYAGTSKKDRD 123 Query: 114 ETAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQE 173 A + L+ VGL ++ + P LSGGQ+QRVA+AR+L IL DEPT LD +T E Sbjct: 124 ARAARALENVGLGNRMDHKPNELSGGQRQRVAVARALINNPSIILADEPTGNLDTKTSIE 183 Query: 174 VLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSE 222 ++ +++EI H T+++VTHE A+ A RI+ M DG I + + ++ Sbjct: 184 IMGLLEEI-HSKGNTIILVTHEEDIAQH-AHRIVRMRDGLIENDYLNTD 230 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 252 Length adjustment: 24 Effective length of query: 218 Effective length of database: 228 Effective search space: 49704 Effective search space used: 49704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory