Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate CA265_RS15880 CA265_RS15880 sugar ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc04256 (361 letters) >FitnessBrowser__Pedo557:CA265_RS15880 Length = 330 Score = 145 bits (365), Expect = 2e-39 Identities = 86/241 (35%), Positives = 141/241 (58%), Gaps = 8/241 (3%) Query: 2 TSVSVRDLSLNFGAVTV--LDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQ 59 T +SV++L+ + A + ++ +I G+ + ++G SG GKSTLL I GLL +G+ Sbjct: 4 TIISVKNLTKQYQAEQAGGIKNVSFEIKQGDVVAIIGESGSGKSTLLKSIYGLLKTDEGE 63 Query: 60 IFIKDRNVTWEE----PKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVK 115 IF +D+ V + P + + MV Q ++L V N++ L + + EK ++ Sbjct: 64 IFFEDKRVKGPDEQLIPGHKQMKMVTQDFSLNIYAKVYDNIASQLSNTDLK-TKAEKTLQ 122 Query: 116 RASEILQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVE 175 E L+I PL +K ELSGG++QRVAI +A+V D V L DEP S +DA L+++LR + Sbjct: 123 -IMEHLRILPLQNKKIIELSGGEQQRVAIAKAMVADTQVLLLDEPFSQVDALLKNQLRAD 181 Query: 176 IKRLHQSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIG 235 IKR+ T+I V+HD + L LAD++ ++K+G + Q P IY P++++ A +G Sbjct: 182 IKRVASETGVTVILVSHDPADGLFLADQLLILKNGELLQTGKPSEIYQHPKHIYTAQILG 241 Query: 236 S 236 + Sbjct: 242 N 242 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 330 Length adjustment: 29 Effective length of query: 332 Effective length of database: 301 Effective search space: 99932 Effective search space used: 99932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory