Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate CA265_RS15880 CA265_RS15880 sugar ABC transporter ATP-binding protein
Query= TCDB::Q9WXN4 (268 letters) >FitnessBrowser__Pedo557:CA265_RS15880 Length = 330 Score = 126 bits (317), Expect = 5e-34 Identities = 78/252 (30%), Positives = 137/252 (54%), Gaps = 17/252 (6%) Query: 6 VKNLTKIFSLGFFSKRRIEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPPTSG 65 VKNLTK + + +KNVSFE+K+ ++V+++GESGSGK+T K I LL G Sbjct: 8 VKNLTKQYQA-----EQAGGIKNVSFEIKQGDVVAIIGESGSGKSTLLKSIYGLLKTDEG 62 Query: 66 EIYFEGKDIWKDIKDRESLVEFRRKVHAVFQDPFASYNPFYPVERTLWQAISLLENKPSN 125 EI+FE K + E L+ +++ V QD S N + V + +S + K Sbjct: 63 EIFFEDKRVKGP---DEQLIPGHKQMKMVTQD--FSLNIYAKVYDNIASQLSNTDLK--T 115 Query: 126 KKEALELIKESLFRVGIDPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEPTSMI 185 K E I E L + + K ++ ++SGG++QR+ IA+ + +++ DEP S + Sbjct: 116 KAEKTLQIMEHLRILPLQNKKII-----ELSGGEQQRVAIAKAMVADTQVLLLDEPFSQV 170 Query: 186 DASSRGGIIKLLEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVERGHPDKVVLE 245 DA + + ++ + E G ++I ++HD +++D + ++KNGE+++ G P ++ Sbjct: 171 DALLKNQLRADIKRVASETGVTVILVSHDPADGLFLADQLLILKNGELLQTGKPSEIYQH 230 Query: 246 PTHEYTKLLVGS 257 P H YT ++G+ Sbjct: 231 PKHIYTAQILGN 242 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 330 Length adjustment: 26 Effective length of query: 242 Effective length of database: 304 Effective search space: 73568 Effective search space used: 73568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory