Align TM0029, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate CA265_RS18010 CA265_RS18010 peptide transporter
Query= TCDB::Q9WXN6 (280 letters) >FitnessBrowser__Pedo557:CA265_RS18010 Length = 380 Score = 105 bits (262), Expect = 2e-27 Identities = 71/222 (31%), Positives = 119/222 (53%), Gaps = 10/222 (4%) Query: 57 LGTDTYGRDVLAQLLHGIRSSLYIGFLAAIISLVIGTIIGSFSAVKRGIVDDVLMGITNI 116 LGTD YGRD+L++L+ GIR SL +G +A +ISL IG +G+ + G VD + N+ Sbjct: 157 LGTDIYGRDLLSRLILGIRVSLSVGLMAVLISLFIGVSLGAIAGYFGGRVDAAISWFMNV 216 Query: 117 VLTTPSILIAILIASYLKVRSVEMVAVILGLFQWPWFARAIRAQLMSVMSREYVYLSVMA 176 V + PS+L+ I I S+ + + + +GL W AR +R Q+M++ E+V + Sbjct: 217 VWSLPSLLLVIAI-SFALGKGFWQIFIAVGLSTWVDVARLVRGQVMALKEVEFVEAARAL 275 Query: 177 GYSDLRLVIEDLIPTIATYAFMSFVLFINGGIMGEAGLSLIGLGPTQGI-SLGIMLQ--- 232 G+S R +I+ ++P IA + I+ E GLS +G G + S G M++ Sbjct: 276 GFSTSRTIIKHILPNIAGPILVVASSNFASAILLETGLSFLGFGAQPPMPSWGSMIKEHY 335 Query: 233 WAVLMEAVRRGLWWWFVPPGLAIVAVTASLLVISTAMDEVFN 274 ++M+A + V PGLAI+ + V++ + + F+ Sbjct: 336 GYIIMDAA-----YLAVLPGLAIMFTVYAFNVLAIGLRDAFD 372 Lambda K H 0.330 0.144 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 380 Length adjustment: 28 Effective length of query: 252 Effective length of database: 352 Effective search space: 88704 Effective search space used: 88704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory