GapMind for catabolism of small carbon sources

 

Aligments for a candidate for cbtD in Pedobacter sp. GW460-11-11-14-LB5

Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate CA265_RS10520 CA265_RS10520 ABC transporter ATP-binding protein

Query= TCDB::Q97VF5
         (362 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS10520 CA265_RS10520 ABC
           transporter ATP-binding protein
          Length = 568

 Score =  176 bits (445), Expect = 2e-48
 Identities = 94/272 (34%), Positives = 162/272 (59%), Gaps = 2/272 (0%)

Query: 45  ILEVHNLNV-IYDEGNSRIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPP 103
           +L V +LN+  Y++      KAV  +SF V+KG +LGI+GESGSGK+    +I+R     
Sbjct: 1   MLNVEHLNIDFYNQEEKTWFKAVKQISFKVKKGTVLGIVGESGSGKSVTSFSIMRLHDER 60

Query: 104 GKIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHG 163
              I+G++ F  + + +++ +E R++    IS + Q    +LNPV           + H 
Sbjct: 61  AAKITGEIDFEDISLLNLSSNEIRQIRGNQISMIFQEPMTSLNPVFTCGYQVAEAIMLHR 120

Query: 164 EADKKRVIERASELLKLVGLD-PARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEP 222
           + D+    +    L   V L  P ++ + YP Q+SGG KQRVMIA++L  +PKL++ DEP
Sbjct: 121 KVDQAEAKKHTIALFNEVQLPRPEKIFESYPHQISGGQKQRVMIAMALSCDPKLLIADEP 180

Query: 223 TSALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEE 282
           T+ALD+  Q+ +L+L+  + QE  + +++++HD+  + +IA+ + VMYKG ++E+G  + 
Sbjct: 181 TTALDVTVQKTILQLLLKLKQERNMAMIFISHDLGVVNEIADEVAVMYKGEIVEQGPAKS 240

Query: 283 IIKSPLNPYTSLLVSSIPSLKGEVKVINVPLD 314
           I ++P +PYT  L++  PS   ++K + V  D
Sbjct: 241 IFENPQHPYTKGLLACRPSPNRQLKKLPVVAD 272



 Score =  162 bits (410), Expect = 2e-44
 Identities = 105/267 (39%), Positives = 152/267 (56%), Gaps = 21/267 (7%)

Query: 45  ILEVHNLNVIYDEGNSRI------IKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILR 98
           +L++ NL   Y   N         +KAV+ ++F V  GE LG++GESG GKTTL   ILR
Sbjct: 309 LLQIKNLCTWYPIHNGLFGKTTDYVKAVDQLNFEVFPGETLGLVGESGCGKTTLGRTILR 368

Query: 99  AIRPPGKIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNPVLPISE----- 153
            I+P     SG++IFNG +I  +     RKL  KDI  + Q    +LNP L I +     
Sbjct: 369 LIQPT----SGEIIFNGENITHIGKTALRKLR-KDIQIIFQDPYASLNPKLSIGQSILEP 423

Query: 154 IFYHEAISHGEADKKRVIERASELLKLVGLDPARVLKMYPFQLSGGMKQRVMIALSLLLN 213
           +  H+   +    K++V+E    LL  VGL        YP + SGG +QRV+IA +L L 
Sbjct: 424 LQVHKLYRNDSERKQKVLE----LLDKVGLKEEH-FNRYPHEFSGGQRQRVVIARALALQ 478

Query: 214 PKLILMDEPTSALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGY 273
           PK I+ DE  SALD+  Q  +L LIK++  E G+T ++++HD+  +  I++R+LVM KG 
Sbjct: 479 PKFIICDESVSALDVSVQAQVLNLIKDLQSEFGLTYIFISHDLAVVKHISDRILVMNKGK 538

Query: 274 VMEEGKTEEIIKSPLNPYTSLLVSSIP 300
           + EEG  E+I  +P   YT  L+ +IP
Sbjct: 539 IEEEGFPEQIFYAPKAAYTQKLIEAIP 565


Lambda     K      H
   0.319    0.138    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 473
Number of extensions: 20
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 362
Length of database: 568
Length adjustment: 33
Effective length of query: 329
Effective length of database: 535
Effective search space:   176015
Effective search space used:   176015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory