Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate CA265_RS04175 CA265_RS04175 phosphonate ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__Pedo557:CA265_RS04175 Length = 232 Score = 102 bits (253), Expect = 9e-27 Identities = 70/229 (30%), Positives = 121/229 (52%), Gaps = 21/229 (9%) Query: 3 LRTENLTVSYGTDKV----LNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGT 58 ++ ENL Y T++V LN ++L + G+ +++GP+GCGKSTLLN L P++G+ Sbjct: 2 IKIENLEKVYKTEEVETTALNGINLHVAAGEFVSIMGPSGCGKSTLLNVMGLLDKPENGS 61 Query: 59 VFLGDNPINMLSSRQLA----RRLSLLPQHHLTPEGITVQELVS----YGRNPWLSLWGR 110 D + L+ R+ + R + + Q+ + +TV E + Y + P Sbjct: 62 YKFIDTELLTLNDRERSNFRKRNMGFVFQNFNLIDELTVFENIELPLIYNKIP------- 114 Query: 111 LSAEDNARVNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLD 170 + E VN + + I + + +LSGGQ+QR +A L +VL DEPT LD Sbjct: 115 -AGERKKLVNEIIERMNIVNRSGHFPQQLSGGQQQRVAVARALVTKPKLVLADEPTGNLD 173 Query: 171 INHQVDLMRLMGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQ 219 +H ++M L+ EL G T+V V H + AS + ++++ + +GHV+++ Sbjct: 174 SSHGNEVMELLCELNETGTTIVMVTHSSHDAS-FSNRIINLKDGHVISE 221 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 125 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 232 Length adjustment: 23 Effective length of query: 232 Effective length of database: 209 Effective search space: 48488 Effective search space used: 48488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory