Align acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17] (characterized)
to candidate CA265_RS18530 CA265_RS18530 aspartate aminotransferase family protein
Query= reanno::Marino:GFF3099 (404 letters) >FitnessBrowser__Pedo557:CA265_RS18530 Length = 382 Score = 201 bits (510), Expect = 4e-56 Identities = 134/386 (34%), Positives = 205/386 (53%), Gaps = 20/386 (5%) Query: 19 YAPGSIIPVRGEGSRIWDQEGREFIDLQGGIAVTCLGHSHPGLVGALHDQAEKIWHLSNV 78 Y I + GS +WD ++++DL GG AV +GH++P V L DQ K+ SN Sbjct: 7 YPLNDIEITKAAGSNVWDANDQQYLDLYGGHAVISIGHTNPHYVNRLTDQLNKVGFYSNS 66 Query: 79 MTNEPALRLAKTLCDLTFAE--RVFFANSGAEANEAAFKLARRYAWEHHGKEKNEIISFK 136 + ++LA+ L +++ + ++F NSGAEANE A KLA Y +G++K +I+F Sbjct: 67 VKIPLQVQLAEKLGEVSGKKDFQLFLCNSGAEANENALKLASFY----NGRKK--VIAFT 120 Query: 137 NSFHGRTLFTVSVGGQPKYLEGFEPAPGGIHHAEFND--LESVKKLISKEKTCAIVVEPI 194 +FHGRT V+V PK + I N+ LE K E + A+++E I Sbjct: 121 GAFHGRTSLAVAVTDNPKIVAPVNQTENVIFLPFNNEIALEETFKAQGNEIS-AVIIEGI 179 Query: 195 QGEGGVMPGDQAFLQGLRDLCDENDALLVFDEVQSGVGRSGHFYAYQMYGVVPDILSSAK 254 QG GG+ ++FLQ +R LCDE +A+ + D VQ G GR+G FY++ GV D+ + AK Sbjct: 180 QGVGGIKEASKSFLQKIRSLCDEYNAVYIADSVQCGYGRTGSFYSHDYSGVEADVYTMAK 239 Query: 255 GLGGGFPVAAMLTTAKVAASLGVGTHGSTYGGNALACAVAQRVVDTVSQPEILKGVKARS 314 G+G GFPVA + +K G G+T+GGN LACA A V++ + + ++K + Sbjct: 240 GMGNGFPVAGISIASKFKP--WHGELGTTFGGNHLACAAALAVLEVMEKDNLIKNAEEVG 297 Query: 315 DKLRKGMMDIGERYGVFTEVRGAGLLLGCVLTEKWQGKAKDFLNAGLEEGVMVLVAGANV 374 + L + +++ EVRG GL++G L + K+ L + A NV Sbjct: 298 NYLIAEL----KKFEQVVEVRGRGLMIGIELPAELAHVKKELL---FTHHIFTGEAKPNV 350 Query: 375 IRLAPSLIIPEPDIELALERFEAAVK 400 IRL P+L + + + L FE AVK Sbjct: 351 IRLLPALNLTKAHADEFLAAFEKAVK 376 Lambda K H 0.318 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 21 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 382 Length adjustment: 31 Effective length of query: 373 Effective length of database: 351 Effective search space: 130923 Effective search space used: 130923 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory