Align succinate-semialdehyde dehydrogenase (NAD+) (EC 1.2.1.24) (characterized)
to candidate CA265_RS21385 CA265_RS21385 aldehyde dehydrogenase family protein
Query= BRENDA::Q6A2H0 (535 letters) >FitnessBrowser__Pedo557:CA265_RS21385 Length = 465 Score = 153 bits (387), Expect = 1e-41 Identities = 103/342 (30%), Positives = 169/342 (49%), Gaps = 10/342 (2%) Query: 193 QPXGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSG 252 +P GV +I PWN+P +I + +A+AAG V++KP+E + +A +++L S + Sbjct: 104 EPKGVCLIIAPWNYPLQLIMSPLVSAIAAGNCVILKPSELSAATADVISKLISN----TF 159 Query: 253 VYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAP 312 I C +A EV A+ P I FTGST GK+++ AA ++ V++ELGG +P Sbjct: 160 EAEEIACFEGDA-EVSTALLKLPF-DHIFFTGSTAIGKVVMEAAAKNLTSVTLELGGKSP 217 Query: 313 FIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGN 372 IV ++ ++ +A K N GQTC+ + L++ I F + A++K + Sbjct: 218 AIVDETCDLKKAAEKIAWGKLVNAGQTCIAPDYVLIKENISADFEMYYQAAVQK-MFFNE 276 Query: 373 GFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDM 432 +IN K +++ K + +A+ GA + GGK + PTLL +V + Sbjct: 277 AAINKNDYAKIINIKQFQRLNKLIEEAIRDGAVLAFGGKSDEQNLT-ITPTLLTSVAESS 335 Query: 433 LCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGV 492 EE FGP+ PVI + +EAI + N LA Y +S ++ + G V Sbjct: 336 AIMQEEIFGPVLPVITYQNLQEAIDVVNRKAKPLALYIFSDSTTNQNKIISETSAGGTCV 395 Query: 493 NEGL--ISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCY 532 N+ L I + + PFGGV SG+G +G + + V + Sbjct: 396 NDVLVHIGNPDLPFGGVNNSGIGSCHGIFGFKTFSHERAVVF 437 Lambda K H 0.319 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 535 Length of database: 465 Length adjustment: 34 Effective length of query: 501 Effective length of database: 431 Effective search space: 215931 Effective search space used: 215931 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory