Align Purine nucleoside phosphorylase 1; PNP 1; Inosine phosphorylase; Inosine-guanosine phosphorylase; Purine nucleoside phosphorylase I; PNP I; Pu-NPase I; EC 2.4.2.1 (characterized)
to candidate CA265_RS16505 CA265_RS16505 purine-nucleoside phosphorylase
Query= SwissProt::P77834 (274 letters) >FitnessBrowser__Pedo557:CA265_RS16505 Length = 271 Score = 259 bits (661), Expect = 6e-74 Identities = 129/268 (48%), Positives = 180/268 (67%), Gaps = 1/268 (0%) Query: 5 AIEQAAQFLKEKFPT-SPQIGLILGSGLGVLADEIEQAIKIPYSDIPNFPVSTVEGHAGQ 63 AIE+ +++K K P+IG+ILG+GLG L EIE ++ YS+IPNFP+ST+E H+G+ Sbjct: 4 AIEETVEYIKRKTENFKPEIGIILGTGLGGLVKEIEVEHQLMYSNIPNFPISTLEFHSGK 63 Query: 64 LVYGQLEGATVVVMQGRFHYYEGYSFDKVTFPVRVMKALGVEQLIVTNAAGGVNESFEPG 123 L++G L G ++ MQGR HYYEGYS ++TFPVRVMK LG+E LIV+NAAG +N F+ G Sbjct: 64 LIFGTLNGKKIIAMQGRLHYYEGYSMQQITFPVRVMKGLGIENLIVSNAAGSLNPEFKKG 123 Query: 124 DLMIISDHINNMGGNPLIGPNDSALGVRFPDMSEAYSKRLRQLAKDVANDIGLRVREGVY 183 DLMII+DHIN NPL G +S LG RFPDMS+ Y + + A ++A ++ + +GVY Sbjct: 124 DLMIIADHINLQPDNPLRGLIESELGPRFPDMSQPYKRDIIAKALEIAKNVDINCHKGVY 183 Query: 184 VANTGPAYETPAEIRMIRVMGGDAVGMSTVPEVIVARHAGMEVLGISCISNMAAGILDQP 243 VA +GP ET AE + +R++G DAVGMSTVPEVIVA HAG+ V IS +++ QP Sbjct: 184 VAVSGPNLETKAEYKYLRLIGADAVGMSTVPEVIVANHAGLPVFAISVLTDEGFPEDLQP 243 Query: 244 LTHDEVIETTEKVKADFLRFVKAIVRNM 271 DE++ K + + ++ + Sbjct: 244 FNLDEILAAAAKAEPKMTEILTRLISEL 271 Lambda K H 0.319 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 271 Length adjustment: 25 Effective length of query: 249 Effective length of database: 246 Effective search space: 61254 Effective search space used: 61254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate CA265_RS16505 CA265_RS16505 (purine-nucleoside phosphorylase)
to HMM TIGR01700 (purine nucleoside phosphorylase I, inosine and guanosine-specific (EC 2.4.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01700.hmm # target sequence database: /tmp/gapView.9904.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01700 [M=249] Accession: TIGR01700 Description: PNPH: purine nucleoside phosphorylase I, inosine and guanosine-specific Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-102 326.0 0.1 8.5e-102 325.8 0.1 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS16505 CA265_RS16505 purine-nucleoside Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS16505 CA265_RS16505 purine-nucleoside phosphorylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 325.8 0.1 8.5e-102 8.5e-102 1 248 [. 22 268 .. 22 269 .. 0.97 Alignments for each domain: == domain 1 score: 325.8 bits; conditional E-value: 8.5e-102 TIGR01700 1 diaiilGsGlGelaekvedavildyseiPefpestveGhkGklvfGklegkkvvilqGrfhlyegydl 68 +i+iilG+GlG l++++e + l ys+iP+fp st e h+Gkl+fG+l+gkk++++qGr+h+yegy++ lcl|FitnessBrowser__Pedo557:CA265_RS16505 22 EIGIILGTGLGGLVKEIEVEHQLMYSNIPNFPISTLEFHSGKLIFGTLNGKKIIAMQGRLHYYEGYSM 89 589***************************************************************** PP TIGR01700 69 akvtfPvrvlkllGvealvvtnaaGgintefkvGdlmlikdhinllalnPliGpneekfGarfpdmsd 136 +++tfPvrv+k lG+e+l+v+naaG++n+efk+Gdlm+i dhinl + nPl+G e+++G+rfpdms+ lcl|FitnessBrowser__Pedo557:CA265_RS16505 90 QQITFPVRVMKGLGIENLIVSNAAGSLNPEFKKGDLMIIADHINLQPDNPLRGLIESELGPRFPDMSQ 157 ******************************************************************** PP TIGR01700 137 aydkelrqkakeiakelditlkeGvyvavtGPsyetpaevrllkklGadavGmstvpevivarhcGlr 204 y +++++ka eiak++di+ ++Gvyvav+GP+ et ae++ l+ +GadavGmstvpeviva+h+Gl lcl|FitnessBrowser__Pedo557:CA265_RS16505 158 PYKRDIIAKALEIAKNVDINCHKGVYVAVSGPNLETKAEYKYLRLIGADAVGMSTVPEVIVANHAGLP 225 ******************************************************************** PP TIGR01700 205 vlglslitnkaagildaelsdheevlevakkakekleklvsalv 248 v+++s++t+++ d + + +e+l +a ka+ k+++++++l+ lcl|FitnessBrowser__Pedo557:CA265_RS16505 226 VFAISVLTDEGF-PEDLQPFNLDEILAAAAKAEPKMTEILTRLI 268 **********99.34444448********************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (249 nodes) Target sequences: 1 (271 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.53 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory