Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate CA265_RS19000 CA265_RS19000 NADP-dependent malic enzyme
Query= curated2:Q9ZKU4 (519 letters) >FitnessBrowser__Pedo557:CA265_RS19000 Length = 771 Score = 210 bits (534), Expect = 2e-58 Identities = 120/327 (36%), Positives = 191/327 (58%), Gaps = 8/327 (2%) Query: 196 AFQRSLEKKAKKQIKKVVLPESEDERILKAAHRLNLMGAVGLILLGDKEAINSQAKNLNL 255 A R++ KAK K+VV E+++ +ILKAA +N ILLG+K+ I + L Sbjct: 428 AIMRAITTKAKTDPKRVVFAEADNYKILKAAQIVNDENIAIPILLGNKDKIQAIIDEHGL 487 Query: 256 NLENVEII----NPNTSHYREEFAKSLYELRKSKGLSEQEAERLALDKTYFATMLVHLGY 311 LE VEII NP+ + +++A++LY+ R+ KG+S +A +L D+ Y+ +V G Sbjct: 488 ELEGVEIIDQMQNPDKT---KQYAEALYQKRQRKGVSLTDATKLLRDRNYYGASMVEFGE 544 Query: 312 AHAMVSGVNHTTAETIRPALQIIKTKPGVSLVSSVFLMCLDTQVFVFGDCAIIPNPSPKE 371 A AM+SG+ TI+PAL +I P V V+ +++M FGD + +P+ +E Sbjct: 545 ADAMISGLTKNYGSTIKPALHVIGVDPSVKRVAGMYMMMTKKGPVFFGDTTVNVDPTAEE 604 Query: 372 LAEIATTSAQTAKQFNIAPKVALLSYATGNSAQGEMIDKINEALTIVQKLDPQLEIDGPL 431 L +I ++ KQFNI P++ALLSY+ S G +K+ E + ++ K P++ +DG + Sbjct: 605 LVDITLLLDKSVKQFNIKPRIALLSYSNFGSNDGVTPNKVRETVKLLHKNHPEVIVDGEM 664 Query: 432 QFDASIDKGVAKKKMPNSQVA-GQASVFIFPDLNAGNIAYKAVQRSAKAVAIGPILQGLN 490 Q + +I+ + K P S +A A+ +FP+L +GNIAYK +Q A A+GPIL GLN Sbjct: 665 QGNFAINNELLKDNFPFSTLADAPANTLVFPNLESGNIAYKLLQELGGAEAVGPILLGLN 724 Query: 491 KPINDLSRGALVEDIVNTVLISAIQAQ 517 KP++ + G+ V +IVN V I+ + Q Sbjct: 725 KPVHIVQLGSSVREIVNMVTIAVVDVQ 751 Lambda K H 0.316 0.132 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 702 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 519 Length of database: 771 Length adjustment: 38 Effective length of query: 481 Effective length of database: 733 Effective search space: 352573 Effective search space used: 352573 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory