Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate CA265_RS15110 CA265_RS15110 NAD(P)-dependent oxidoreductase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__Pedo557:CA265_RS15110 Length = 252 Score = 76.3 bits (186), Expect = 6e-19 Identities = 59/188 (31%), Positives = 93/188 (49%), Gaps = 12/188 (6%) Query: 16 LISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDR-ARTAHP-------QLHAGVADVS 67 LI+GA +GIG A AQ F G N+ + DR A+ AH + ADV Sbjct: 6 LITGATSGIGEACAQTFAQQGYNLILL---ARREDRLAKIAHHLEDKYAITIKQVFADVR 62 Query: 68 DCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRK 127 D + ++ ++ +D+LINNAG++ ++ D +W+ I TN+ Y + K Sbjct: 63 DKESLAAALEVLPAEWKKVDVLINNAGLSQGLDPIDKGDTNDWDTMIDTNVKGLLY-VTK 121 Query: 128 AVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAI 187 V + + II + S+AG+ Y Y ASK A+ + K + I+L P+ ++V I Sbjct: 122 IVSNWMIPNQSGHIINIGSIAGKEVYPNGNVYCASKHAVDALSKGMRIDLLPHGIKVTEI 181 Query: 188 LPGVVEGE 195 PG+VE E Sbjct: 182 NPGMVETE 189 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 252 Length adjustment: 24 Effective length of query: 239 Effective length of database: 228 Effective search space: 54492 Effective search space used: 54492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory