Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate CA265_RS04230 CA265_RS04230 short-chain dehydrogenase
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__Pedo557:CA265_RS04230 Length = 256 Score = 119 bits (298), Expect = 6e-32 Identities = 79/248 (31%), Positives = 128/248 (51%), Gaps = 9/248 (3%) Query: 15 VLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRD-KYPGTVATRADVSDAAQIE 73 ++++GGA GIG A AY +AGA V + D + A + + + +A ++ + ++ Sbjct: 9 IILTGGADGIGWECAKAYSKAGATVCILDKNPIAESKLNELETAQKIAITCNLVNENEVA 68 Query: 74 AVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAVPMLK 133 A F+ + G +D + NNAGIA P+ +D +DAEW +N+NL + + + LK Sbjct: 69 AAFETIIQKFGNIDAIHNNAGIAHPSKTLDQTTDAEWDLLMNVNLKSILYTTRYGIEQLK 128 Query: 134 ESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPGIVEG 193 ++ G +L+ +S+ G +G Y ATK AI L K++A + IRVNA+ P + Sbjct: 129 KTK-GCILNTSSMVGTIGQDNHAAYVATKGAINALTKAMALDYAPYQIRVNAVSPAAINT 187 Query: 194 PRMDGVIRARAEQVGVPEAEMRQEYLNKIS-LKRMVTAEDVAAMALFLCSPAARNVTGQA 252 P + + + P E Q YL+K+ L M + +A LFL S AAR +TG Sbjct: 188 PTLQLWSKEQ------PNKEEIQHYLDKLQPLGGMPAGDVIADACLFLLSDAARFITGTI 241 Query: 253 ISVDGNVE 260 + V G E Sbjct: 242 LPVSGGAE 249 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 256 Length adjustment: 24 Effective length of query: 238 Effective length of database: 232 Effective search space: 55216 Effective search space used: 55216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory