Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate CA265_RS04990 CA265_RS04990 short chain dehydrogenase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__Pedo557:CA265_RS04990 Length = 272 Score = 75.1 bits (183), Expect = 1e-18 Identities = 57/184 (30%), Positives = 92/184 (50%), Gaps = 14/184 (7%) Query: 15 VLISGAAAGIGAAIAQAFLDVGAN--------VYICDVDPAAIDRARTAHPQLHAGVADV 66 ++I+GA++GIG A A+ F GAN V +C++ D + + + A ADV Sbjct: 8 IIITGASSGIGKACAEEFAKRGANLVLAARQYVTLCEI---TADLEKKYNIRAVAVQADV 64 Query: 67 SDCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLR 126 S + II A +D+L+NNAG++ DLD + + + N Y + Sbjct: 65 SKETDCELIIKQALVSFQKIDVLVNNAGLS-MRALFNDLDLSVLKNLMDVNFWGTVYCTK 123 Query: 127 KAVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNA 186 A+P + +T ++ ++S+AG G RT Y+ASK+A+ G ++SL EL V V Sbjct: 124 YALPEILKTKGT--VVGVSSIAGFRGLPGRTGYSASKFAMNGFMESLRTELLKTGVNVLL 181 Query: 187 ILPG 190 PG Sbjct: 182 ACPG 185 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 125 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 272 Length adjustment: 25 Effective length of query: 238 Effective length of database: 247 Effective search space: 58786 Effective search space used: 58786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory